SAXSdb — 8ixl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein G8P

Inovirus M13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Tail virion protein G9P × 5 （P69538） Tail virion protein G7P × 5 （P69535）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSD_BPM13
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–50； UniProt 24–73 Author chain AA； PDBConstruct 1–50； UniProt 24–73 Author chain B； PDBConstruct 1–50； UniProt 24–73 Author chain C； PDBConstruct 1–50； UniProt 24–73 Author chain CA； PDBConstruct 1–50； UniProt 24–73 Author chain DA； PDBConstruct 1–50； UniProt 24–73 Author chain E； PDBConstruct 1–50； UniProt 24–73 Author chain EA； PDBConstruct 1–50； UniProt 24–73 Author chain FA； PDBConstruct 1–50； UniProt 24–73 Author chain G； PDBConstruct 1–50； UniProt 24–73 Author chain H； PDBConstruct 1–50； UniProt 24–73 Author chain HA； PDBConstruct 1–50； UniProt 24–73 Author chain I； PDBConstruct 1–50； UniProt 24–73 Author chain JA； PDBConstruct 1–50； UniProt 24–73 Author chain K； PDBConstruct 1–50； UniProt 24–73 Author chain M； PDBConstruct 1–50； UniProt 24–73 Author chain N； PDBConstruct 1–50； UniProt 24–73 Author chain O； PDBConstruct 1–50； UniProt 24–73 Author chain P； PDBConstruct 1–50； UniProt 24–73 Author chain R； PDBConstruct 1–50； UniProt 24–73 Author chain T； PDBConstruct 1–50； UniProt 24–73 Author chain V； PDBConstruct 1–50； UniProt 24–73 Author chain W； PDBConstruct 1–50； UniProt 24–73 Author chain X； PDBConstruct 1–50； UniProt 24–73 Author chain Z； PDBConstruct 1–50； UniProt 24–73

Tail virion protein G9P

Inovirus M13

UniProt P69538

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Capsid protein G8P × 25 （P69541） Tail virion protein G7P × 5 （P69535）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9P_BPM13
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–32； UniProt 1–32 Author chain GA； PDBConstruct 1–32； UniProt 1–32 Author chain J； PDBConstruct 1–32； UniProt 1–32 Author chain Q； PDBConstruct 1–32； UniProt 1–32 Author chain Y； PDBConstruct 1–32； UniProt 1–32

Tail virion protein G7P

Inovirus M13

UniProt P69535

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Capsid protein G8P × 25 （P69541） Tail virion protein G9P × 5 （P69538）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G7P_BPM13
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain BA； PDBConstruct 1–33； UniProt 1–33 Author chain F； PDBConstruct 1–33； UniProt 1–33 Author chain IA； PDBConstruct 1–33； UniProt 1–33 Author chain L； PDBConstruct 1–33； UniProt 1–33 Author chain S； PDBConstruct 1–33； UniProt 1–33

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ixl
Deposition date deposition_date	2023-04-01
Structure title title	top segment of the bacteriophage M13 mini variant
Keywords keywords	Viral coat protein, M13, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ixl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ixl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ixl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.00 Å
Rg (electron density)	39.09 Å
Total Rg	39.36 Å
Atom count	10970
Residues	1455
Excluded volume	200860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ixl__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Capsid protein G8P
Molecular weight formula_weight	5243.0 kDa
Source method src_method	man
Copy count entity_count	25

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,B,C,E,H,A,G,I,K,M,N,O,P,R,T,V,W,X,AA,CA,DA,EA,FA,HA,JA
Atom count atom_count	10970

AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS

Source Source

Source organism organism	Inovirus M13
NCBI taxonomy ID ncbi_taxonomy_id	1977402
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Tail virion protein G9P
Molecular weight formula_weight	3655.3 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,J,Q,Y,GA

MSVLVYSFASFVLGWCLRSGITYFTRLMETSS

Source Source

Source organism organism	Inovirus M13
NCBI taxonomy ID ncbi_taxonomy_id	1977402
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Tail virion protein G7P
Molecular weight formula_weight	3603.2 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,L,S,BA,IA

MEQVADFDTIYQAMIQISVVLCFALGIIAGGQR

Source Source

Source organism organism	Inovirus M13
NCBI taxonomy ID ncbi_taxonomy_id	1977402
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	20910

top segment of the bacteriophage M13 mini variant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein G8P

State in the Current Structure

Other States of the Same Protein in the Database

Tail virion protein G9P

State in the Current Structure

Other States of the Same Protein in the Database

Tail virion protein G7P

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ixl__assembly_1__model_1

8ixl__assembly_1__model_1 | I(q)

8ixl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

top segment of the bacteriophage M13 mini variant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein G8P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail virion protein G9P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail virion protein G7P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ixl__assembly_1__model_1

8ixl__assembly_1__model_1 | I(q)

8ixl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)