SAXSdb — 8oej

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication factor A

Pyrococcus abyssi

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 1	RPA32 subunit of the hetero-oligomeric complex involved in homologous recombination × 2 （Q9V1Z1） RPA14 subunit of the hetero-oligomeric complex involved in homologous recombination × 2 （Q9V1Z0） poly dT × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G8ZHS0_PYRAB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–358； UniProt 3–358 Author chain D； PDBConstruct 3–358； UniProt 3–358

RPA32 subunit of the hetero-oligomeric complex involved in homologous recombination

Pyrococcus abyssi

UniProt Q9V1Z1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 1	Replication factor A × 2 （G8ZHS0） RPA14 subunit of the hetero-oligomeric complex involved in homologous recombination × 2 （Q9V1Z0） poly dT × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9V1Z1_PYRAB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–269； UniProt 6–272 Author chain H； PDBConstruct 3–269； UniProt 6–272

RPA14 subunit of the hetero-oligomeric complex involved in homologous recombination

Pyrococcus abyssi

UniProt Q9V1Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 1	Replication factor A × 2 （G8ZHS0） RPA32 subunit of the hetero-oligomeric complex involved in homologous recombination × 2 （Q9V1Z1） poly dT × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9V1Z0_PYRAB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 7–122； UniProt 2–117 Author chain I； PDBConstruct 7–122； UniProt 2–117

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8oej
Deposition date deposition_date	2023-03-10
Structure title title	Extended RPA-DNA nucleoprotein filament
Keywords keywords	DNA replication, single strand DNA-binding protein, RPA, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8oej__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8oej__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8oej__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.86 Å
Rg (electron density)	56.69 Å
Total Rg	56.47 Å
Atom count	9886
Residues	1178
Excluded volume	176350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8oej__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Replication factor A
Molecular weight formula_weight	41009.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	9928

MSVLTKDRIIEIIERKTGMSREEIEEEIRKIMEEDPYLSEQGAAALLAERLGIDLIEKEEVSLMRISELYPGMDPREVNVVGRVLKKYPPREYTRKDGSVGRVASLIIYDDSGRARVVLWDAKVSEYYNKIEVGDVIKVLDAQVKESLSGLPELHINFRARIILNPDDPRVEMIPPLEEVRVATYTRKKIKDIEAGDRFVEVRGTIAKVYRVLTYDACPECKKKVDYDEGLGVWICPEHGEVQPIKMTILDFGLDDGTGYIRVTLFGDDAEELLGVSPEEIAEKIKELEESGLTTKEAARKLAEDEFYNIIGREIVVRGNVIEDRFLGLILRASSWEDVDYRREIERIKEELEKLGVM

Source Source

Source organism organism	Pyrococcus abyssi
NCBI taxonomy ID ncbi_taxonomy_id	29292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	RPA32 subunit of the hetero-oligomeric complex involved in homologous recombination
Molecular weight formula_weight	31489.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,H

MSKKRMPATRLYIKDILEGYFVKSEGDFEPNYLITKYARKVYRAKIVGTVVREPLIAEDETYGKFQVDDGTGVIWVLGFRDDTKFAKLVRKGDLVQVIGKIAEWRDDKQILVEGVSKVHPNMWILHRYETLKEKIEHIKKAKIALEIYNQYGITAKSKVIAKNKGIEEELLEVIDELYGIMMEERSIEEPMEELLEEEIPEEKEENELLEKAKEDILNILRQKRTAISRKYILKKLGDKYDEETIDDAITELLAQGEIYEPETGYYKLL

Source Source

Source organism organism	Pyrococcus abyssi
NCBI taxonomy ID ncbi_taxonomy_id	29292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	RPA14 subunit of the hetero-oligomeric complex involved in homologous recombination
Molecular weight formula_weight	14008.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,I

GTGDGSEVQVRRRKPAVERKISEIREEDTRVSLIGRVIKVDKMDYMFWLDDGTGVAIIESESDLPKVGQVVRVIGRIIRNEEGIHIYAEVIQDFSDADLEALEEIRELERKLLPRLEGEIVW

Source Source

Source organism organism	Pyrococcus abyssi
NCBI taxonomy ID ncbi_taxonomy_id	29292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	poly dT
Molecular weight formula_weight	30374.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT

Entity 5 Entity 5 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Resolution resolution	7.960 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Extended RPA-DNA nucleoprotein filament

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication factor A

State in the Current Structure

Other States of the Same Protein in the Database

RPA32 subunit of the hetero-oligomeric complex involved in homologous recombination

State in the Current Structure

Other States of the Same Protein in the Database

RPA14 subunit of the hetero-oligomeric complex involved in homologous recombination

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8oej__assembly_1__model_1

8oej__assembly_1__model_1 | I(q)

8oej__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)

Extended RPA-DNA nucleoprotein filament

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication factor A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RPA32 subunit of the hetero-oligomeric complex involved in homologous recombination

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RPA14 subunit of the hetero-oligomeric complex involved in homologous recombination

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8oej__assembly_1__model_1

8oej__assembly_1__model_1 | I(q)

8oej__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)