8oki

Cryo-EM structure of Pyrococcus furiosus transcription elongation complex bound to Spt4/5

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit Rpo1N

Pyrococcus furiosus DSM 3638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5C0XPL7_PYRFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–910； UniProt 1–910

DNA-directed RNA polymerase subunit beta

Pyrococcus furiosus DSM 3638

UniProt Q8U0M3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U0M3_PYRFU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1117； UniProt 1–1117

DNA-directed RNA polymerase subunit Rpo1C

Pyrococcus furiosus DSM 3638

UniProt Q8U0M5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPO1C_PYRFU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–397； UniProt 1–397

DNA-directed RNA polymerase subunit Rpo3

Pyrococcus furiosus DSM 3638

UniProt Q8U0E4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPO3_PYRFU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–261； UniProt 1–261

Transcription elongation factor Spt5

Pyrococcus furiosus DSM 3638

UniProt Q8TZK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPT5_PYRFU
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–152； UniProt 1–152

DNA-directed RNA polymerase subunit Rpo5

Pyrococcus furiosus DSM 3638

UniProt Q8U0M2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPO5_PYRFU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–82； UniProt 1–82

Transcription elongation factor Spt4

Pyrococcus furiosus DSM 3638

UniProt Q8U440

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPT4_PYRFU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–61； UniProt 1–61

DNA-directed RNA polymerase subunit Rpo6

Pyrococcus furiosus DSM 3638

UniProt Q8U0E8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPO6_PYRFU
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–57； UniProt 1–57

DNA-directed RNA polymerase subunit Rpo11

Pyrococcus furiosus DSM 3638

UniProt Q8U4N1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPO11_PYRFU
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–95； UniProt 1–95

DNA-directed RNA polymerase subunit Rpo10

Pyrococcus furiosus DSM 3638

UniProt P60292

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPO10_PYRFU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–65； UniProt 1–65

DNA-directed RNA polymerase subunit Rpo12

Pyrococcus furiosus DSM 3638

UniProt Q8TZI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPO12_PYRFU
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain P； PDBConstruct 1–49； UniProt 1–49

DNA-directed RNA polymerase subunit Rpo7

Pyrococcus furiosus DSM 3638

UniProt Q8U439

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo4 × 1 （Q8U216） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U439_PYRFU
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain E； PDBConstruct 1–189； UniProt 1–189

DNA-directed RNA polymerase subunit Rpo4

Pyrococcus furiosus DSM 3638

UniProt Q8U216

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 13 DNA 2 RNA 1	DNA-directed RNA polymerase subunit Rpo1N × 1 （A0A5C0XPL7） DNA-directed RNA polymerase subunit beta × 1 （Q8U0M3） DNA-directed RNA polymerase subunit Rpo1C × 1 （Q8U0M5） DNA-directed RNA polymerase subunit Rpo3 × 1 （Q8U0E4） Transcription elongation factor Spt5 × 1 （Q8TZK1） DNA-directed RNA polymerase subunit Rpo5 × 1 （Q8U0M2） Transcription elongation factor Spt4 × 1 （Q8U440） DNA-directed RNA polymerase subunit Rpo6 × 1 （Q8U0E8） DNA-directed RNA polymerase subunit Rpo11 × 1 （Q8U4N1） DNA-directed RNA polymerase subunit Rpo10 × 1 （P60292） DNA-directed RNA polymerase subunit Rpo12 × 1 （Q8TZI3） DNA Template Strand × 1 DNA Non-Template Strand × 1 RNA × 1 DNA-directed RNA polymerase subunit Rpo7 × 1 （Q8U439） ZINC ION × 6 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U216_PYRFU
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain F； PDBConstruct 1–120； UniProt 1–120

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8oki
Deposition date deposition_date	2023-03-28
Structure title title	Cryo-EM structure of Pyrococcus furiosus transcription elongation complex bound to Spt4/5
Keywords keywords	RNA, Polymerase, Elongation complex, Pyrococcus furiosus, DNA, Archaea, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8oki__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8oki__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8oki__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.80 Å
Rg (electron density)	49.99 Å
Total Rg	50.20 Å
Atom count	28556
Residues	3482
Excluded volume	508370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8oki__assembly_1__model_1`	16-meric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase subunit Rpo1N
Molecular weight formula_weight	103612.2 kDa
EC 编号 ec_number	2.7.7.6
Mutation mutation	0
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	28556

MQSMKKVIGSIEFGILSPQEIRKMSAVEVTVPDTYDDDGYPIEGGVMDKRMGVIDPGLRCETCGGRAGECPGHFGHIELARPVIHVGFAKTIYRILESTCRECGRIKLTDEEIEEYMKKIELARNRRSEFNEIIKEIHKKAKERMVCPHCGAPQYPIKFEKPTIYWEIRKDEQGNEYRHRLMPTEVRDWLEKIPDKDLPLLGLDPEKSRPEWMVLTVLPVPPVTARPSITLETGIRAEDDLTHKLVDIIRINNRLKQNIEAGAPQLIIEDLWDLLQYHVTTYINNEAPGVPPAKHKSGRPLKTLAQRLKGKEGRFRGNLSGKRVNFSARTVISPDPMISINEVGVPVEVAMELTVPEKVTEFNIERLRKMVLNGPDKYPGANYVIDPEGRRRRIMDSNKETLANQLDIGWTVERHLMDGDIVLFNRQPSLHRMSIMAHRVRVMPYRTFRLNLAVCPPYNADFDGDEMNLHVPQTEEAQAEARILMEVQNHIISPRYGGPIIGGIQDHISGGYLLTREGAYFTRDEVEQMLMFAGVDITELPEPDKYDENGNPLWSGKTIFSLLLPEDLTVWYRNKLCDEPERCEALEKLIEEKLMPDPEEVRKLAYDGFVYIQNGKLLSGAIDKKAYGREDGIILDLIVREYGVERARQFLDQVTKLTIWVITHKGFTTGIDDEDLPEEARDRIREIIREAEERVNKLIEAYKRGELEPLPGKSLEDTLESLIMAVLAEARDNAGAVAEKYLGMDNHTVIMAKTGARGKILNITQMAALLGQQSIRGKRLYRGFRGRVLSHFKPGDLGARAKGFVVNSYKSGLTPQEYFFHAMGGREGLVDTAVRTAQSGYMQRRLINALQDLKVEYDGTVRSPEGIIVQFKYGEDGVDPMKSWRGKTVDVDRIIVRTLLKMRGNNKAKV

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	127188.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MRGPTVVDVTPDDLWIVMESYWQEKGLVRQHLDSYNAFIERGLQEVVNEFGGIKPDIPDFEVKFGKIRVGEPEFQEPHGQRKPLYPMDARIRNLTYAAPLYLEMIPVIKGVEQDPVEVRIGELPIMLKSKVCRLYGLSDEELIKLGEDPKDPGGYFIINGSERVIVSIEDIAPNRTLVEKDERQEKYIAKVFSYRHGYRALVAVERRKDGILYVDIPNVPKPVKFVYVMRALGLERDKDIVEAVGNDPEVQQIMFDNLEDASDITTQQEALEFIGKLVAPGQAREYRLKRAEYVIDNNLLPHMGVSPEDRIKKAYYLGMMALKVIELSLGRRPEDDKDHYANKRLRLAGDLLKDLFRVAFSQLVKDIQYQMTKTYQRKGDKYTFGNIHRFIRNSIRPDVLTERIEHALATGAWPGGRTGVSQLLDRTNYMSTLSHLRRVTSPLDREQPHFEARDLHGTHWGRICPTETPEGPNCGLVKNLALMAQITTAVPEEEIREYLMSLGIVPIEVRRPDPTLWRVYLNGVLIGTIEDGKALVQRIRQDRRSGKISDVINVAYYEDVKEVYVNSDDGRVRRPLIIVENGVPKLTKEHVQAVKEGRLKWSDLIKMGIIEYLDAEEEENAYVAMWPWEVTEEHTHLELMPAAILGLPASLVPYPEHNAAPRNTYGAGMAKQSLGLGWANFRIRVDTRGHLLHYPQIPLVNSRIMKAVGYEDRPAGQNFVVAVLAYQGYNMEDAIIINKASIERGLARSTFFRTYEAEEKKYLGGQTDKFEIPDPTVRGYRGEKYYRNLDEDGLIFPESKVEGKDVLVGRTSPPRFLEERGLGTVSLQERRETSVAVRPSEKGVVDKVIITETGDGTKLVKVTVRDLRIPELGDKFASRHGQKGVIGLIVPQEDMPWTESGIVPDLIVNPHGIPSRMTVGQLIEAIGGKVASLKGRRVDGTAFIGEPEEKLRKELEELGFKHTGREIMYDGITGKRLEADIFIGVIYYQRLHHMVADKIHARSRGPVQVLTKQPTEGRAREGGLRFGEMERDVLVGHGAAMLLIERLLEESDKTEVWVCENCGHIALEDKRRRRVYCPVCGEEERISKVEMSYAFKLLLDELKAMVIRPKLNLSERV

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase subunit Rpo1C
Molecular weight formula_weight	44468.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MVSLSTIKSLIEKKGANLPENVKSELYEKLKKYNEKYKLTKAEIEAIIDDVVKEYERALVEPGEPVGTVAAQSIGEPSTQMTLNTFHYAGVAEINVTLGLPRIIEIVDARKNPSTPMMTVYLDEEHRYDRAKAEEVARRIEGTTLENLARSTTLDLINFEFIVEIDPERLERSGLTMEKVVKKLESSFKSAEFEVDGYTLIVRPKKADKISDLRRFAEKIKKHRLKGLSGVGKTIVRKEGDEYVIYTEGSNFKQVLKVPGVDPTRTRTNNIHEIAEVLGIEAARNAIIDEIVSTMQEQGLEVDIRHIMLVADMMTLDGIVRPIGRHGVVGEKSSVLARAAFEITVQHLFEAAEKGEVDNLNGVIENVLIGQPVPVGTGMVKLTMKLPLRPQKEKEEV

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase subunit Rpo3
Molecular weight formula_weight	31688.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAGIEVQILEKKEDSIKFVLKGVHVSFANALRRTILGEVPTFAVDEVEFYENDSALFDEIIAHRLAMIPLTTPVDRFELDALELDDYTVTLSLEAEGPGIVYSGDLKSDDPDVKPVNPNIPIVKLAEGQRLVFNAYAKLGRGKDHAKWQPGFVYYKYYTIVHISKSIPEWKELKKLAKKRGLPVEETEEEVLVTTIKPFYIPKDFEEYEGKEIWEEIVPNTYIFTVETNGELPVEEIVSIALKILMRKADRFISELQKLTSWSHPQFEKHHHHHH

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 5 Entity 5 polymer

Description description	Transcription elongation factor Spt5
Molecular weight formula_weight	16816.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAGKIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFLEEKPAVSGLEPGDLVEVIAGPFKGQKAKVVKIDESKDEVVVQFIDAIVPIPVTIKGDYVRLISKLQKEE

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase subunit Rpo5
Molecular weight formula_weight	9260.8 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAGKKEFSIFDHVLVPEHRVLSEEEKKALLEKYKITLAQLPQIKASDPAVKALGAKPGDVIEIKRKSPTAGVYYYYRVVVED

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 7 Entity 7 polymer

Description description	Transcription elongation factor Spt4
Molecular weight formula_weight	6965.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSEKACRHCHYITSEDRCPVCGSRDLSEEWFDLVIIVDVENSEIAKKIGAKVPGKYAIRVR

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase subunit Rpo6
Molecular weight formula_weight	6243.5 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MFKYTRFEKARIIGARALQISMGAPVLIDVPPGITPLEAAILEFEKGVIPITVIRPS

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase subunit Rpo11
Molecular weight formula_weight	11132.8 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MKIEVIKKEENLLEFYLEGEDHTFANLLVETLRENPHVKFTAYTIEHPITMARKPRFRVVTDGEITPEEALEEAAKKIFERAKEVLEAWEKAVKS

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase subunit Rpo10
Molecular weight formula_weight	7800.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MIVPVRCFTCGKVIGDKYYEFKRRVEAGEDPEKVLDDLGLERYCCRRMLLSHVELIDDIMHYRVY

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase subunit Rpo12
Molecular weight formula_weight	5770.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MVEAVYRCFKCGREVKLDLSITRDLRCPYCGSKILYKPRPKVPRRVKAI

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 12 Entity 12 polymer

Description description	DNA Template Strand
Molecular weight formula_weight	8043.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

GGGAAGTAGTTACGCCTGGTCATTAC

Entity 13 Entity 13 polymer

Description description	DNA Non-Template Strand
Molecular weight formula_weight	7932.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

GTAATGACCAGGCGTAACTACTTCCC

Entity 14 Entity 14 polymer

Description description	RNA
Molecular weight formula_weight	2909.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

GACCAGGCG

Entity 15 Entity 15 polymer

Description description	DNA-directed RNA polymerase subunit Rpo7
Molecular weight formula_weight	21731.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MYKIVTVKDVVRIPPTMFTMDPKEAAKIILRETYEGTYDKDEGVILSILEVKDIKDGIIIPGDGATYHEVVFDVLVWEPKIHEVVEGYVADVMPFGAFIRIGPIDGLVHISQLMDDYVVYDERNKQFVGKEKKYLLKIGDLVRARIINISAKSKVIRENRIGLTMRQPGLGKFEWIEKEKKKEKEEGKK

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 16 Entity 16 polymer

Description description	DNA-directed RNA polymerase subunit Rpo4
Molecular weight formula_weight	14116.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MIGRGKLGEKYITIAEAKELLLKRREEEVKAGIEEPLYYEARLALEHAERFAKLPADKAKEAVEELMNAFEWMSDRIACKIVDIMPEDSMDLRVIFAKEEYQPTQEEMKQILDILDKYRE

Source Source

Source organism organism	Pyrococcus furiosus DSM 3638
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Pyrococcus furiosus DSM 3638

Entity 17 Entity 17 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 18 Entity 18 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.45 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	52527

Cryo-EM structure of Pyrococcus furiosus transcription elongation complex bound to Spt4/5

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit Rpo1N

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit Rpo1C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit Rpo3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription elongation factor Spt5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit Rpo5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription elongation factor Spt4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit Rpo6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit Rpo11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit Rpo10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer