SAXSdb — 8p0y

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

Mengla dianlovirus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	C-terminal domain of Mengla nucleoprotein × 1 C-terminal domain of Mengla nucleoprotein × 1 C-terminal domain of Mengla nucleoprotein × 1	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1Q1NMU1_9MONO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–130； UniProt 573–697 Author chain O； PDBConstruct 6–130； UniProt 573–697 Author chain P； PDBConstruct 6–130； UniProt 573–697 Author chain Q； PDBConstruct 6–130； UniProt 573–697 Author chain R； PDBConstruct 6–130； UniProt 573–697 Author chain S； PDBConstruct 6–130； UniProt 573–697 Author chain T； PDBConstruct 6–130； UniProt 573–697 Author chain U； PDBConstruct 6–130； UniProt 573–697 Author chain V； PDBConstruct 6–130； UniProt 573–697 Author chain W； PDBConstruct 6–130； UniProt 573–697 Author chain X； PDBConstruct 6–130； UniProt 573–697 Author chain Y； PDBConstruct 6–130； UniProt 573–697 Author chain Z； PDBConstruct 6–130； UniProt 573–697 Author chain a； PDBConstruct 6–130； UniProt 573–697

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8p0y
Deposition date deposition_date	2023-05-11
Structure title title	The crystal structure of the C-terminal domain of Mengla nucleoprotein
Keywords keywords	Nucleoprotein, viral protein, Filovirus, Mengla; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8p0y__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8p0y__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8p0y__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.28 Å
Rg (electron density)	53.59 Å
Total Rg	53.19 Å
Atom count	8000
Residues	989
Excluded volume	140840 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8p0y__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Nucleoprotein
Molecular weight formula_weight	14277.5 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,Z,Y,T,P,S,X,W,Q,R,U,a,O,A
Atom count atom_count	8000

GPLGSGDMGAAEHTLDPFGDMPPLETDVLTPQDTATVPSAPPSSPTPSTNRQGEAQTQNGEDSSQDWPRRVKTNKGREFMFPTDLLHRTPPQVLLDALVNEYESPLSATELSDDWPEMTFEERKNVAFNL

Source Source

Source organism organism	Mengla dianlovirus
NCBI taxonomy ID ncbi_taxonomy_id	2496529
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	C-terminal domain of Mengla nucleoprotein
Molecular weight formula_weight	443.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

XXXXX

Source Source

Source organism organism	Mengla dianlovirus
NCBI taxonomy ID ncbi_taxonomy_id	2496529
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	C-terminal domain of Mengla nucleoprotein
Molecular weight formula_weight	2826.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Mengla dianlovirus
NCBI taxonomy ID ncbi_taxonomy_id	2496529
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	C-terminal domain of Mengla nucleoprotein
Molecular weight formula_weight	2911.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Mengla dianlovirus
NCBI taxonomy ID ncbi_taxonomy_id	2496529
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	177.182 Å
Unit-cell length b length_b	177.182 Å
Unit-cell length c length_c	90.953 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	42

Space group space_group	P 32
Space-group number int_tables_number	145
Crystal system crystal_system	trigonal

Resolution resolution	4.120 Å
Low-resolution limit resolution_low	48.900 Å
R factor r_factor	0.2380
R_work r_work	0.2362
R_free r_free	0.2681

The crystal structure of the C-terminal domain of Mengla nucleoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8p0y__assembly_1__model_1

8p0y__assembly_1__model_1 | I(q)

8p0y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

The crystal structure of the C-terminal domain of Mengla nucleoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8p0y__assembly_1__model_1

8p0y__assembly_1__model_1 | I(q)

8p0y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)