SAXSdb — 8poo

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ktr system potassium uptake protein B

Bacillus subtilis subsp. subtilis str. 168

UniProt O32081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Ktr system potassium uptake protein A × 4 （O32080）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Ktr system potassium uptake protein A × 4 （O32080）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KTRB_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–445； UniProt 1–445 Author chain B； PDBConstruct 1–445； UniProt 1–445 Author chain I； PDBConstruct 1–445； UniProt 1–445 Author chain J； PDBConstruct 1–445； UniProt 1–445

Ktr system potassium uptake protein A

Bacillus subtilis subsp. subtilis str. 168

UniProt O32080

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Ktr system potassium uptake protein B × 2 （O32081）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Ktr system potassium uptake protein B × 2 （O32081）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KTRA_BACSU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–144； UniProt 1–144 Author chain C； PDBConstruct 149–282； UniProt 7–140 Author chain D； PDBConstruct 1–144； UniProt 1–144 Author chain D； PDBConstruct 149–282； UniProt 7–140 Author chain E； PDBConstruct 1–144； UniProt 1–144 Author chain E； PDBConstruct 149–282； UniProt 7–140 Author chain G； PDBConstruct 1–144； UniProt 1–144 Author chain G； PDBConstruct 149–282； UniProt 7–140

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8poo
Deposition date deposition_date	2023-07-05
Last revision last_revision	2024-05-15
Structure title title	Low resolution structure of inactive conformation of the Ktr cation channel in presence of ATP and c-di-AMP
Keywords keywords	Ktr channel, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8poo__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8poo__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8poo__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.59 Å
Rg (electron density)	42.80 Å
Total Rg	43.08 Å
Atom count	14560
Residues	1884
Excluded volume	264160 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8poo__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8poo__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Ktr system potassium uptake protein B
Molecular weight formula_weight	48471.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,A,B
Atom count atom_count	20736

MTLQKDKVIKWVRFTPPQVLAIGFFLTIIIGAVLLMLPISTTKPLSWIDALFTAASATTVTGLAVVDTGTQFTVFGQTVIMGLIQIGGLGFMTFAVLIVMILGKKIGLKERMLVQEALNQPTIGGVIGLVKVLFLFSISIELIAALILSIRLVPQYGWSSGLFASLFHAISAFNNAGFSLWPDNLMSYVGDPTVNLVITFLFITGGIGFTVLFDVMKNRRFKTFSLHTKLMLTGTLMLNAIAMLTVFILEYSNPGTLGHLHIVDKLWASYFQAVTPRTAGFNSLDFGSMREGTIVFTLLLMFIGAGSASTASGIKLTTFIVILTSVIAYLRGKKETVIFRRSIKYPIIIKALAVSVTSLFIVFLGIFALTITEQAPFLQIVFETFSAFGTVGLTMGLTPELTTAGKCIIIVIMFIGRIGPLTFVFSFAKTEQSNIRYPDGEVFTG

Source Source

Source organism organism	Bacillus subtilis subsp. subtilis str. 168
NCBI taxonomy ID ncbi_taxonomy_id	224308
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Ktr system potassium uptake protein A
Molecular weight formula_weight	32038.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,G

MGRIKNKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNYLEGSKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENLELVPR

Source Source

Source organism organism	Bacillus subtilis subsp. subtilis str. 168
NCBI taxonomy ID ncbi_taxonomy_id	224308
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	127.795 Å
Unit-cell length b length_b	143.686 Å
Unit-cell length c length_c	160.669 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	112.37 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	5.770 Å
Low-resolution limit resolution_low	48.000 Å
R factor r_factor	0.4069
R_work r_work	0.4047
R_free r_free	0.4256

Low resolution structure of inactive conformation of the Ktr cation channel in presence of ATP and c-di-AMP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ktr system potassium uptake protein B

State in the Current Structure

Other States of the Same Protein in the Database

Ktr system potassium uptake protein A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8poo__assembly_2__model_1

8poo__assembly_2__model_1 | I(q)

8poo__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Low resolution structure of inactive conformation of the Ktr cation channel in presence of ATP and c-di-AMP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ktr system potassium uptake protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ktr system potassium uptake protein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8poo__assembly_2__model_1

8poo__assembly_2__model_1 | I(q)

8poo__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)