SAXSdb — 8qkh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN7_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–292； UniProt 1–292

Baseplate hub assembly protein

OrganismNot specified

UniProt A1YTN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Capsid protein × 6 （A1YTN7） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN9_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–278； UniProt 1–278

Putative non-cytoplasmic protein

OrganismNot specified

UniProt A0A0U1WZ69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WZ69_9CAUD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain N； PDBConstruct 1–87； UniProt 1–87 Author chain n； PDBConstruct 1–87； UniProt 1–87

Non-cytoplasmic protein

OrganismNot specified

UniProt A0A0U1WIM1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Putative neck protein × 12 （A1YTN6） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WIM1_9CAUD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain S； PDBConstruct 1–152； UniProt 1–152 Author chain s； PDBConstruct 1–152； UniProt 1–152

Putative neck protein

OrganismNot specified

UniProt A1YTN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN6_9CAUD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain a； PDBConstruct 1–302； UniProt 1–302 Author chain b； PDBConstruct 1–302； UniProt 1–302

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qkh
Deposition date deposition_date	2023-09-15
Structure title title	Neck of phage 812 virion (C6)
Keywords keywords	phage, neck, portal, connector, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qkh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qkh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qkh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.85 Å
Rg (electron density)	68.45 Å
Total Rg	68.41 Å
Atom count	74232
Residues	9126
Excluded volume	1326200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qkh__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Capsid protein
Molecular weight formula_weight	33757.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	12372

MEKPYMIGANSNPNVINKSTTYTTTTQADEQDKPKYTTRLEFDTIDMIRFINDRGIKVLWEEAYFCPCLNPDTGHPRVDCPRCHGKGIAYLPPKETIMAIQSQEKGTNQLDIGILDTGTAIGTTQLEKRISYRDRFTVPEVLMPQQMIYFVNKDRIKKGIPLYYDVKEITYIATQDGTVYEEDYEIKNNRLYLNEKYENHTVTLKILMTLRYVVSDILKESRYQYTKFNQPKSKFENLPQKLLLKREDVIVLQDPYKVNDGIEEDLEIQVDDPKASASNPSNLGGFFGGAFK

Entity 2 Entity 2 polymer

Description description	Baseplate hub assembly protein
Molecular weight formula_weight	31799.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAITSVDSYLLSEIKPRLNTVLENCYIIDEVLKDFDYQTRESFKEAFCGKNAQHEVTVGFNFPKFKNNYEAHYLIQLGQGQETKNSLGSIQSSYFEATGDTLVESSTAIREDDKLVFTVSKPIGELIKVEDIEFAKYDNLQVEGNKVSFKYQTNEDYENYNANIIFTEKKNDSKGLVKGFTVEEQVTVVGLSFNVDVARCLDAVLKMILISMRDSIEEQQTFQLQNLSFGDIAPIIEDGDSMIFGRPTIIKYTSSLDLDYTITQDINKLTFKERKDWK

Entity 3 Entity 3 polymer

Description description	Putative non-cytoplasmic protein
Molecular weight formula_weight	10146.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,n

MSIEKKEEVIAHNEVVFRSLTQGLYVKEVDIYSDVVSYTKDVDEALAMPNTINFKNSRKYKKLIMNLDLEPLNKIQKVIYETHLEGL

Entity 4 Entity 4 polymer

Description description	Non-cytoplasmic protein
Molecular weight formula_weight	17885.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

MADEISLNPIQDAKPIDDIVDIMTYLKNGKVLRVKQDNQGDILVRMSPGKHKFTEVSRDLDKESFYYKRHWVLYNVSVNSLITFDVYLDEEYSETTKVKYPKDTIVEYTREDQEKDVAMIKEILTDNNGNYFYALIGETMLFDENKLNKVKD

Entity 5 Entity 5 polymer

Description description	Putative neck protein
Molecular weight formula_weight	34191.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b

MVNSMFGGDLDPYEKSLNYEYPYHPSGNPKHIDVSEIDNLTLADYGWSPDAVKAYMFGIVVQNPDTGQPMGDEFYNHILERAVGKAERALDISILPDTQHEMRDYHETEFNSYMFVHAYRKPILQVENLQLQFNGRPIYKYPANWWKVEHLAGHVQLFPTALMQTGQSMSYDAVFNGYPQLAGVYPPSGATFAPQMIRLEYVSGMLPRKKAGRNKPWEMPPELEQLVIKYALKEIYQVWGNLIIGAGIANKTLEVDGITETIGTTQSAMYGGASAQILQINEDIKELLDGLRAYFGYNMIGL

Entity 6 Entity 6 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.15 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	21731

Neck of phage 812 virion (C6)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Baseplate hub assembly protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative non-cytoplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

Non-cytoplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative neck protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qkh__assembly_1__model_1

8qkh__assembly_1__model_1 | I(q)

8qkh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Neck of phage 812 virion (C6)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate hub assembly protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative non-cytoplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Non-cytoplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative neck protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qkh__assembly_1__model_1

8qkh__assembly_1__model_1 | I(q)

8qkh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)