8rla

RECQL5:sfGFP hetero dimer assembled by Di-Gluebody - RECQL5 local refinement

Method: ELECTRON MICROSCOPY D_max: 87.9 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP-dependent DNA helicase Q5

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 12–453	Not recorded	Gluebody G5-006 × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.03 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8RLA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4BK0 Crystal structure of the KIX domain of human RECQL5 (domain-swapped dimer) Deposited 2013-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 515–620（106 aa） Fragment：KIX DOMAIN, RESIDUES 515-620 Chain B 515–620（106 aa） Fragment：KIX DOMAIN, RESIDUES 515-620	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.2；0.2 M NACL, 0.1 M SODIUM/POTASSIUM PHOSPHATE PH 6.2, 50% PEG 200	Resolution 1.90 Å R-free 0.234
5LB3 Crystal structure of human RECQL5 helicase in complex with ADP/Mg. Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；23% PEG6K, 0.15M lithium chloride, 2.5% ethylene glycol	Resolution 1.80 Å R-free 0.234
5LB3 Crystal structure of human RECQL5 helicase in complex with ADP/Mg. Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；23% PEG6K, 0.15M lithium chloride, 2.5% ethylene glycol	Resolution 1.80 Å R-free 0.234
5LB5 Crystal structure of human RECQL5 helicase in complex with ADP/Mg (tricilinc form). Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 10–453（444 aa）	Not recorded	ZN ZINC ION × 1 DMS DIMETHYL SULFOXIDE × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1M tris pH 7.5, 23% PEG3350, 0.1M sodium chloride	Resolution 2.00 Å R-free 0.282
5LB5 Crystal structure of human RECQL5 helicase in complex with ADP/Mg (tricilinc form). Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 10–453（444 aa）	Not recorded	ZN ZINC ION × 1 DMS DIMETHYL SULFOXIDE × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1M tris pH 7.5, 23% PEG3350, 0.1M sodium chloride	Resolution 2.00 Å R-free 0.282
5LB5 Crystal structure of human RECQL5 helicase in complex with ADP/Mg (tricilinc form). Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 10–453（444 aa）	Not recorded	ZN ZINC ION × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1M tris pH 7.5, 23% PEG3350, 0.1M sodium chloride	Resolution 2.00 Å R-free 0.282
5LB5 Crystal structure of human RECQL5 helicase in complex with ADP/Mg (tricilinc form). Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 10–453（444 aa）	Not recorded	ZN ZINC ION × 1 DMS DIMETHYL SULFOXIDE × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1M tris pH 7.5, 23% PEG3350, 0.1M sodium chloride	Resolution 2.00 Å R-free 0.282
5LB8 Crystal structure of human RECQL5 helicase APO form. Deposited 2016-06-15	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–526（516 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；17.5% Peg 3350, 0.2M Potassium Thiocyanate, 0.1M Hepes pH 7.0, 10% ethelene glycol	Resolution 3.40 Å R-free 0.322
5LB8 Crystal structure of human RECQL5 helicase APO form. Deposited 2016-06-15	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 11–526（516 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；17.5% Peg 3350, 0.2M Potassium Thiocyanate, 0.1M Hepes pH 7.0, 10% ethelene glycol	Resolution 3.40 Å R-free 0.322
5LBA Crystal structure of human RECQL5 helicase in complex with DSPL fragment(1-cyclohexyl-3-(oxolan-2-ylmethyl)urea, SGC - Diamond XChem I04-1 fragment screening. Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 11–453（443 aa）	Not recorded	MG MAGNESIUM ION × 1 ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 DMS DIMETHYL SULFOXIDE × 1 6SV 1-cyclohexyl-3-[[(2~{R})-oxolan-2-yl]methyl]urea × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M tris pH 9.0 -- 29% PEG3350 -- 0.1M sodium chloride	Resolution 2.50 Å R-free 0.303
5LBA Crystal structure of human RECQL5 helicase in complex with DSPL fragment(1-cyclohexyl-3-(oxolan-2-ylmethyl)urea, SGC - Diamond XChem I04-1 fragment screening. Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–453（443 aa）	Not recorded	MG MAGNESIUM ION × 1 ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M tris pH 9.0 -- 29% PEG3350 -- 0.1M sodium chloride	Resolution 2.50 Å R-free 0.303
5LBA Crystal structure of human RECQL5 helicase in complex with DSPL fragment(1-cyclohexyl-3-(oxolan-2-ylmethyl)urea, SGC - Diamond XChem I04-1 fragment screening. Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 11–453（443 aa）	Not recorded	MG MAGNESIUM ION × 1 ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M tris pH 9.0 -- 29% PEG3350 -- 0.1M sodium chloride	Resolution 2.50 Å R-free 0.303
5LBA Crystal structure of human RECQL5 helicase in complex with DSPL fragment(1-cyclohexyl-3-(oxolan-2-ylmethyl)urea, SGC - Diamond XChem I04-1 fragment screening. Deposited 2016-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 11–453（443 aa）	Not recorded	MG MAGNESIUM ION × 1 ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M tris pH 9.0 -- 29% PEG3350 -- 0.1M sodium chloride	Resolution 2.50 Å R-free 0.303
7ZML Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G1-001 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；293 K；0.1M bis-tris pH 5.9 -- 0.1M lithium sulfate -- 30% PEG3350	Resolution 2.79 Å R-free 0.261
7ZML Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G1-001 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；293 K；0.1M bis-tris pH 5.9 -- 0.1M lithium sulfate -- 30% PEG3350	Resolution 2.79 Å R-free 0.261
7ZML Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G1-001 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；293 K；0.1M bis-tris pH 5.9 -- 0.1M lithium sulfate -- 30% PEG3350	Resolution 2.79 Å R-free 0.261
7ZML Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G1-001 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；293 K；0.1M bis-tris pH 5.9 -- 0.1M lithium sulfate -- 30% PEG3350	Resolution 2.79 Å R-free 0.261
7ZMM Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2-001 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2M sodium chloride -- 25% PEG3350 -- 0.1M bis-tris pH 6.5	Resolution 2.50 Å R-free 0.281
7ZMM Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2-001 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2M sodium chloride -- 25% PEG3350 -- 0.1M bis-tris pH 6.5	Resolution 2.50 Å R-free 0.281
7ZMM Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2-001 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2M sodium chloride -- 25% PEG3350 -- 0.1M bis-tris pH 6.5	Resolution 2.50 Å R-free 0.281
7ZMM Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2-001 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2M sodium chloride -- 25% PEG3350 -- 0.1M bis-tris pH 6.5	Resolution 2.50 Å R-free 0.281
7ZMN Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G3-048 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；2M ammonium sulfate -- 0.1M HEPES pH 7.5	Resolution 3.20 Å R-free 0.275
7ZMN Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G3-048 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；2M ammonium sulfate -- 0.1M HEPES pH 7.5	Resolution 3.20 Å R-free 0.275
7ZMO Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G3-052 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1M ammonium sulfate -- 0.5% PEG8000 -- 0.1M HEPES pH 7.0	Resolution 3.75 Å R-free 0.306
7ZMO Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G3-052 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1M ammonium sulfate -- 0.5% PEG8000 -- 0.1M HEPES pH 7.0	Resolution 3.75 Å R-free 0.306
7ZMP Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G3-055 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；2.4M sodium malonate	Resolution 3.63 Å R-free 0.359
7ZMP Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G3-055 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；2.4M sodium malonate	Resolution 3.63 Å R-free 0.359
7ZMQ Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2*-006 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.2M lithium sulfate -- 25% PEG3350 -- 0.1M tris pH 8.5	Resolution 2.70 Å R-free 0.258
7ZMQ Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2*-006 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.2M lithium sulfate -- 25% PEG3350 -- 0.1M tris pH 8.5	Resolution 2.70 Å R-free 0.258
7ZMR Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2*-011 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2M lithium sulfate -- 25% PEG3350 -- 0.1M HEPES pH 7.5	Resolution 3.30 Å R-free 0.292
7ZMR Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G2*-011 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2M lithium sulfate -- 25% PEG3350 -- 0.1M HEPES pH 7.5	Resolution 3.30 Å R-free 0.292
7ZMS Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G4-043 Deposited 2022-04-19	Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 12–453（442 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2M sodium chloride -- 25% PEG3350 -- 0.1M HEPES pH 7.5	Resolution 2.70 Å R-free 0.276
7ZMT Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G5-006 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M sodium formate -- 20% PEG3350	Resolution 2.30 Å R-free 0.291
7ZMT Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G5-006 Deposited 2022-04-19	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M sodium formate -- 20% PEG3350	Resolution 2.30 Å R-free 0.291
7ZMV Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G5-006 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2M ammonium sulfate -- 25% PEG3350 -- 0.1M HEPES pH 7.5	Resolution 2.00 Å R-free 0.275
7ZMV Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G5-006 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2M ammonium sulfate -- 25% PEG3350 -- 0.1M HEPES pH 7.5	Resolution 2.00 Å R-free 0.275
7ZMV Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G5-006 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2M ammonium sulfate -- 25% PEG3350 -- 0.1M HEPES pH 7.5	Resolution 2.00 Å R-free 0.275
7ZMV Crystal structure of human RECQL5 helicase APO form in complex with engineered nanobody (Gluebody) G5-006 Deposited 2022-04-19	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 11–453（443 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2M ammonium sulfate -- 25% PEG3350 -- 0.1M HEPES pH 7.5	Resolution 2.00 Å R-free 0.275
8QQ2 RNAPII elongation complex bound to RECQ5 Deposited 2023-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: hexadecameric	Chain R 1–650（650 aa）	Not recorded	ZN ZINC ION × 8 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
8QW8 In condensate RNAPII elongation complex bound to RECQ5 Deposited 2023-10-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: hexadecameric	Chain R 1–650（650 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 7.70 Å
8QW9 RNAPII elongation complex bound to RECQ5_R502E Deposited 2023-10-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: hexadecameric	Chain R 1–650（650 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.30 Å
8RL5 DNA helicase RECQL5 in complex with homo Di-Gluebody G5-006 Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 12–453（442 aa） Chain B 12–453（442 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.79 Å
8RL6 DNA helicase RECQL5 in complex with homo Di-Gluebody G5-006 - RECQL5 local refinement Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 12–453（442 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
8RL9 RECQL5:sfGFP hetero dimer assembled by Di-Gluebody Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 12–453（442 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.22 Å
9EI1 Cryo-EM structure of Human RNA polymerase II Elongation Complex bound to the RECQL5 helicase in the absence of nucleotide Deposited 2024-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: hexadecameric	Chain U 1–991（991 aa）	Mutation：D157A	ZN ZINC ION × 8 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9EI2 Cryo-EM structure of Human RNA polymerase II Elongation Complex bound to an apo RECQL5 helicase (RECQL5 IRI Module focused-classified) Deposited 2024-11-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain U 1–991（991 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9EI3 Cryo-EM structure of Human RNA polymerase II Elongation Complex bound to the RECQL5 helicase in the presence of AMPPNP Deposited 2024-11-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: hexadecameric	Chain U 1–991（991 aa）	Not recorded	ZN ZINC ION × 8 MG MAGNESIUM ION × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9EI4 Cryo-EM structure of Human RNA polymerase II Elongation Complex bound to the RECQL5 helicase in the presence of ADP Deposited 2024-11-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: hexadecameric	Chain U 1–991（991 aa）	Not recorded	ZN ZINC ION × 8 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9HVO Structure of the transcribing Pol II-RECQL5 complex Deposited 2024-12-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: 16-meric	Chain O 1–991（991 aa）	Not recorded	ZN ZINC ION × 8 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES pH 7.5, 100 mM NaCl, 3 mM MgCl2, 1 mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9HVQ Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex Deposited 2024-12-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 21 PDB declaration: 24-meric	Chain O 1–991（991 aa）	Not recorded	ZN ZINC ION × 8 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES pH 7.5, 50 mM KCl, 4 mM MgCl2, 1 mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.00 Å
9HWG Structure of the transcribing Pol II-TCR-RECQL5 complex Deposited 2025-01-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 21-meric	Chain O 1–991（991 aa）	Not recorded	ZN ZINC ION × 10 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES pH 7.5, 50 mM KCl, 4 mM MgCl2, 1 mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å

28 other PDB entries and 51 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RECQ5_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–442； UniProt 12–453

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8rla
Deposition date deposition_date	2024-01-02
Structure title title	RECQL5:sfGFP hetero dimer assembled by Di-Gluebody - RECQL5 local refinement
Keywords keywords	DNA helicase, Di-Gluebody, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	28.62 Å
Radius of gyration Rg (electron density) rg_electron	27.85 Å
Forward intensity I(0) i0	60695800.00
Molecular weight molecular_weight	60007.0 kDa
Excluded volume excluded_volume	74833 Å³
Envelope volume envelope_volume	94139 Å³
Hydration-shell volume shell_volume	29259 Å³
Envelope diameter envelope_diameter	95.5 Å
Shell Rg shell_rg	33.98 Å
Envelope Rg envelope_rg	27.81 Å
Shape Rg shape_rg	27.81 Å
Total Rg total_rg	28.62 Å
Total atoms total_atoms	8304
Residues n_residues	560
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	87.9 Å
Rg (real space) rg_real	28.58 Å
Rg uncertainty (real space) rg_real_error	0.66 Å
I(0) (real space) i0_real	6.0700e+07
I(0) uncertainty (real space) i0_real_error	8.2950e+05
Rg (reciprocal space) rg_reciprocal	28.60 Å
I(0) (reciprocal space) i0_reciprocal	60700000.0000
Solution quality estimate total_estimate	0.9011
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	86.3 Å
Skewness Skewness skewness	0.227
Kurtosis Kurtosis kurtosis	-0.548
Angular range angular_range	— – 0.2750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9740000.0000
Real-space data points n_real_points	56
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.975; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.990; Smooth: 0.795

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Gluebody G5-006
Molecular weight formula_weight	13775.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K
Atom count atom_count	8304

SMAQVQLVENGGGCVKAGGSLRLSCAASGSIFSINRMTWYRQAPGKEREWVAAITSGGSTNYADSVKGRFTISRDNAENTVYLQMNSLKPEDTAVYYCEAYGTYTLAPTGEGEYDDYWGQGTQVMVS

来源 Source

来源生物 organism	Lama glama
NCBI Class编号 ncbi_taxonomy_id	9844
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ATP-dependent DNA helicase Q5
Molecular weight formula_weight	49203.8 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

PERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSLCYQLPALLAKGITIVVSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQERKELLADLEREKPQTKILYITPEMAASSSFQPTLNSLVSRHLLSYLVVDEAHCVSQWGHDFRPDYLRLGALRSRLGHAPCVALTATATPQVQEDVFAALHLKKPVAIFKTPCFRANLFYDVQFKELISDPYGNLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAYHAGLKASERTLVQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWCRLYYSRNDRDQVSFLIRKEVAKLQEKRGNKASDKATIMAFDALVTFCEELGCRHAAIAKYFGDALPACAKGCDHCQNPTAVRRRLEALERSSSW

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.03 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	359811

fit	/app/data/saxs_computation/rl/8rla/8rla.fit
pddf	/app/data/pr_computation/rl/8rla/8rla.pr.out
profile	/app/data/saxs_computation/rl/8rla/8rla.dat

RECQL5:sfGFP hetero dimer assembled by Di-Gluebody - RECQL5 local refinement

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP-dependent DNA helicase Q5

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)