8rwn

CryoEM structure of the Hdr(ABC)2 subunits of the Elp-Hdr complex of Methanothermobacter marburgensis

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） Non-cubane [4Fe-4S]-cluster × 4 IRON/SULFUR CLUSTER × 10 FLAVIN-ADENINE DINUCLEOTIDE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HDRB_METTM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–302； UniProt 1–302 Author chain b； PDBConstruct 1–302； UniProt 1–302

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C

OrganismNot specified

UniProt Q50754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） Non-cubane [4Fe-4S]-cluster × 4 IRON/SULFUR CLUSTER × 10 FLAVIN-ADENINE DINUCLEOTIDE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HDRC_METTM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–185； UniProt 1–185 Author chain c； PDBConstruct 1–185； UniProt 1–185

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A

OrganismNot specified

UniProt Q50756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） Non-cubane [4Fe-4S]-cluster × 4 IRON/SULFUR CLUSTER × 10 FLAVIN-ADENINE DINUCLEOTIDE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HDRA_METTM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–659； UniProt 1–659 Author chain a； PDBConstruct 1–659； UniProt 1–659

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8rwn
Deposition date deposition_date	2024-02-05
Structure title title	CryoEM structure of the Hdr(ABC)2 subunits of the Elp-Hdr complex of Methanothermobacter marburgensis
Keywords keywords	Redox, Flavin-based electron bifurcation, methanogenesis, heterodisulfide reductase, F420-H2 oxidase, Oxidoreductase; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8rwn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8rwn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8rwn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.98 Å
Rg (electron density)	39.64 Å
Total Rg	39.82 Å
Atom count	27844
Residues	1792
Excluded volume	251850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8rwn__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B
Molecular weight formula_weight	33496.4 kDa
EC 编号 ec_number	1.8.98.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,B
Atom count atom_count	28101

MEIAYFLGCIMNNRYPGIEKATRVLFDKLGIELKDMEGASCCPAPGVFGSFDKTTWAAIAARNITIAEDMGADIMTECNGCFGSLFETNHLLKEDEEMKAKINEILKETGREYKGEVNVRHFAEVLYNDVGLDKLSELVEKPLNLNVAVHYGCHFLKPSDEINIDNPERPTILDEIVEVTGAKSVEYKDKMMCCGAGGGVRSRDLDVALDFTREKLTNMKEAGVDAIVNVCPFCHLQFDVGQMEIKDKFGEEFDIPVLHLAQLLGLAMGLPKEDLVVDAHQVCVDECLEKLEELDRLAPGSG

Entity 2 Entity 2 polymer

Description description	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C
Molecular weight formula_weight	20548.7 kDa
EC 编号 ec_number	1.8.98.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,C

MTLLQREENIIRKGNIDKEFSEKIKAAGGDSLEYCFQCGTCTGSCPSGRRTPYRVRQIIRKANVGLKDEIISDPTLWMCTTCYSCQERCPRKVKIVDVVKLARNEAAKAGFMAPAHKAVGSFVIKTGHGVPINDATMELRKAVGLGELPPTTHQFPEALEEVQKIIKATGFDQLIGYNWETGELE

Entity 3 Entity 3 polymer

Description description	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A
Molecular weight formula_weight	72265.0 kDa
EC 编号 ec_number	1.8.98.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a

MAEEKKETMEEPKIGVYVCHCGVNIGGVVDVEAVRDYAAKLPNVVIAKDYKYYCSDPGQLEIQKDIKELGINRVVVAACSPRLHEPTFRRCVEEAGLNQFLFEFANIREHDSWVHMDNPEGATEKAKDLVRMAVAKARLLEPLEASKVSVDDKALVIGGGVAGIQAALDLADMGFKTYMVEKRPSISGRMGQLDKTFPTLDCSMCILAPKMVDVGKHDNIELITYAEVKEVDGYIGNFKVKIEKKPRYIDEELCTGCGSCVEVCPIEMPNYFDEGIGMTKAVYIPFPQAVPLCATIDKDYCIECMLCDEVCERGAVKHDQEPEEIEIEVGTIIVATGYDAYDPTEKLEYGYGRHTNVITGLELERMINASGPTDGKVLKPSDGEKPKRVAFIHCVGSRDEQIGKPYCSRVCCMYIMKNAQLIKDKMPDTEVTLYYMDIRAFGKGFEEFYKRSQEKYGIKFIRGRPAEVIENPDLTLTVRSEDTLLGKVTEYDYDMVVLGVGLVPPEGAETLRQTIGLSKSADGFLMEAHPKLRPVDTLTDGVYLAGVAQGPKDIPDAVAQASGAAARAAIPMVKGEVEIEPIIAVTDSDVCGGCEVCIELCPFGAISIEEGHANVNVALCKGCGTCVAACPSGAMDQQHFKTEQIMAQIEAALNEPASK

Entity 4 Entity 4 non-polymer

Description description	Non-cubane [4Fe-4S]-cluster
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 6 Entity 6 non-polymer

Description description	FLAVIN-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	785.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	257

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.85 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	493925

CryoEM structure of the Hdr(ABC)2 subunits of the Elp-Hdr complex of Methanothermobacter marburgensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C

State in the Current Structure

Other States of the Same Protein in the Database

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8rwn__assembly_1__model_1

8rwn__assembly_1__model_1 | I(q)

8rwn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)

CryoEM structure of the Hdr(ABC)2 subunits of the Elp-Hdr complex of Methanothermobacter marburgensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8rwn__assembly_1__model_1

8rwn__assembly_1__model_1 | I(q)

8rwn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)