9sw6

Structure of the Mvh-Hdr-Fmd complex of Methanothermobacter marburgensis (composite structure)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HDRA_METTM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–659； UniProt 1–659

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B

OrganismNot specified

UniProt Q50755

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HDRB_METTM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–302； UniProt 1–302

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C

OrganismNot specified

UniProt Q50754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HDRC_METTM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–185； UniProt 1–185

F420-non-reducing hydrogenase iron-sulfur subunit D

OrganismNot specified

UniProt P60238

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MVHD_METTM
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141

F420-non-reducing hydrogenase subunit G

OrganismNot specified

UniProt P60239

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MVHG_METTM
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–308； UniProt 1–308

Tungsten formylmethanofuran dehydrogenase, subunit F

OrganismNot specified

UniProt D9PU51

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D9PU51_METTM
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–349； UniProt 1–349 Author chain h； PDBConstruct 1–349； UniProt 1–349

Tungsten formylmethanofuran dehydrogenase, subunit A

OrganismNot specified

UniProt D9PU54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D9PU54_METTM
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–569； UniProt 1–569 Author chain i； PDBConstruct 1–569； UniProt 1–569

formylmethanofuran dehydrogenase subunit B

OrganismNot specified

UniProt D9PXE7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D9PXE7_METTM
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–436； UniProt 1–436 Author chain j； PDBConstruct 1–436； UniProt 1–436

Tungsten formylmethanofuran dehydrogenase, subunit G

OrganismNot specified

UniProt D9PU52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D9PU52_METTM
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–82； UniProt 1–82 Author chain l； PDBConstruct 1–82； UniProt 1–82

Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C

OrganismNot specified

UniProt P61937

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Polyferredoxin protein MvhB × 2 （P60232） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FMDC_METTM
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–400； UniProt 1–400 Author chain k； PDBConstruct 1–400； UniProt 1–400

Polyferredoxin protein MvhB

OrganismNot specified

UniProt P60232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） F420-non-reducing hydrogenase subunit A × 2 （P60227） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MVHB_METTM
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain G； PDBConstruct 1–412； UniProt 1–412

F420-non-reducing hydrogenase subunit A

OrganismNot specified

UniProt P60227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A × 2 （Q50756） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B × 2 （Q50755） H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C × 2 （Q50754） F420-non-reducing hydrogenase iron-sulfur subunit D × 2 （P60238） F420-non-reducing hydrogenase subunit G × 2 （P60239） Tungsten formylmethanofuran dehydrogenase, subunit F × 4 （D9PU51） Tungsten formylmethanofuran dehydrogenase, subunit A × 4 （D9PU54） formylmethanofuran dehydrogenase subunit B × 4 （D9PXE7） Tungsten formylmethanofuran dehydrogenase, subunit G × 4 （D9PU52） Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C × 4 （P61937） Polyferredoxin protein MvhB × 2 （P60232） IRON/SULFUR CLUSTER × 90 FLAVIN-ADENINE DINUCLEOTIDE × 2 Non-cubane [4Fe-4S]-cluster × 4 FE2/S2 (INORGANIC) CLUSTER × 2 ZINC ION × 8 2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE × 8 MOLYBDENUM ATOM × 4 HYDROSULFURIC ACID × 4 FE3-S4 CLUSTER × 2 formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni) × 2 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MVHA_METTM
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain F； PDBConstruct 1–472； UniProt 1–472

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9sw6
Deposition date deposition_date	2025-10-04
Structure title title	Structure of the Mvh-Hdr-Fmd complex of Methanothermobacter marburgensis (composite structure)
Keywords keywords	Oxidoreductase, hydrogenase, dehydrogenase, polyferredoxin; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9sw6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9sw6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9sw6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	83.55 Å
Rg (electron density)	83.18 Å
Total Rg	82.81 Å
Atom count	183662
Residues	12026
Excluded volume	1667800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9sw6__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A
Molecular weight formula_weight	72265.0 kDa
EC 编号 ec_number	1.8.98.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	92174

MAEEKKETMEEPKIGVYVCHCGVNIGGVVDVEAVRDYAAKLPNVVIAKDYKYYCSDPGQLEIQKDIKELGINRVVVAACSPRLHEPTFRRCVEEAGLNQFLFEFANIREHDSWVHMDNPEGATEKAKDLVRMAVAKARLLEPLEASKVSVDDKALVIGGGVAGIQAALDLADMGFKTYMVEKRPSISGRMGQLDKTFPTLDCSMCILAPKMVDVGKHDNIELITYAEVKEVDGYIGNFKVKIEKKPRYIDEELCTGCGSCVEVCPIEMPNYFDEGIGMTKAVYIPFPQAVPLCATIDKDYCIECMLCDEVCERGAVKHDQEPEEIEIEVGTIIVATGYDAYDPTEKLEYGYGRHTNVITGLELERMINASGPTDGKVLKPSDGEKPKRVAFIHCVGSRDEQIGKPYCSRVCCMYIMKNAQLIKDKMPDTEVTLYYMDIRAFGKGFEEFYKRSQEKYGIKFIRGRPAEVIENPDLTLTVRSEDTLLGKVTEYDYDMVVLGVGLVPPEGAETLRQTIGLSKSADGFLMEAHPKLRPVDTLTDGVYLAGVAQGPKDIPDAVAQASGAAARAAIPMVKGEVEIEPIIAVTDSDVCGGCEVCIELCPFGAISIEEGHANVNVALCKGCGTCVAACPSGAMDQQHFKTEQIMAQIEAALNEPASK

Entity 2 Entity 2 polymer

Description description	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B
Molecular weight formula_weight	33496.4 kDa
EC 编号 ec_number	1.8.98.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MEIAYFLGCIMNNRYPGIEKATRVLFDKLGIELKDMEGASCCPAPGVFGSFDKTTWAAIAARNITIAEDMGADIMTECNGCFGSLFETNHLLKEDEEMKAKINEILKETGREYKGEVNVRHFAEVLYNDVGLDKLSELVEKPLNLNVAVHYGCHFLKPSDEINIDNPERPTILDEIVEVTGAKSVEYKDKMMCCGAGGGVRSRDLDVALDFTREKLTNMKEAGVDAIVNVCPFCHLQFDVGQMEIKDKFGEEFDIPVLHLAQLLGLAMGLPKEDLVVDAHQVCVDECLEKLEELDRLAPGSG

Entity 3 Entity 3 polymer

Description description	H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C
Molecular weight formula_weight	20548.7 kDa
EC 编号 ec_number	1.8.98.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MTLLQREENIIRKGNIDKEFSEKIKAAGGDSLEYCFQCGTCTGSCPSGRRTPYRVRQIIRKANVGLKDEIISDPTLWMCTTCYSCQERCPRKVKIVDVVKLARNEAAKAGFMAPAHKAVGSFVIKTGHGVPINDATMELRKAVGLGELPPTTHQFPEALEEVQKIIKATGFDQLIGYNWETGELE

Entity 4 Entity 4 polymer

Description description	F420-non-reducing hydrogenase iron-sulfur subunit D
Molecular weight formula_weight	15954.4 kDa
EC 编号 ec_number	1.12.99.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAEDDIKIVMFCCNWCSYGGADTAGTARMQYPTNIRVIRVMCSGRIEPQFVFKAFREGADGVLVTGCHHGDCHYDAGNYKLDRRMRLIYKLADELGIGRERIHHDWISASEGEKFAETVKMMVDRIRALGPSPIKKQLAEA

Entity 5 Entity 5 polymer

Description description	F420-non-reducing hydrogenase subunit G
Molecular weight formula_weight	33786.6 kDa
EC 编号 ec_number	1.12.99.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAEKIKIGTMWLGGCSGCHLSIADFHEKLLDVMEHADFEFSPVLMDTKYDEIPELDVVVIEGGIVNDENREFAEELREKAKFVISYGTCAVYGGIPGLRNLWDKDEVIEEAYINSITTPNEEGVIPSEDVPHLEGRVKPLGEVIDVDFEVPGCPPRSDVAAEVVMALLKGEEIELPSTNLCEVCPREKPPEGLAMDFIKRQFEVGKPEDDLCLIPQGLICMGPATVSICGAECPSIAIPCRGCYGPTARVEDQGAKMISAIASDYKVEEDKTVDPEEVAEQLDDIVGTFYTFTLPAALIPMKIKKEGK

Entity 6 Entity 6 polymer

Description description	Tungsten formylmethanofuran dehydrogenase, subunit F
Molecular weight formula_weight	38614.5 kDa
EC 编号 ec_number	1.2.99.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

METTEVIEGKNITVERTGEENRKLIFQDCLCAVCGLCGEICPVSAIEVNPTGAMVRTEQDESKILIDENKCVLCGMCSSICPFQALDLQIDGTSIKELAEYPKILKSAEIDDETCIQCKACETACPQDAITITRELPERKDLITGEIEIDKDTCIYCGMCEEMCPVDAIEIEHQIPSSSSPTVATDINVDEDKCVHCGICKRICPVDAIMQVCRICPYGEYEIKVPEVTGTSYIDPELCVNCGWCQEICPVDAATVTKPFEGELIIDQDTCQACETCVMACPCNVLSFPKPEKSGEKPTKLYKDERFCIYCGACERSCPVNAIEVKRSRINTTPIKSKAWKNAFESLLK

Entity 7 Entity 7 polymer

Description description	Tungsten formylmethanofuran dehydrogenase, subunit A
Molecular weight formula_weight	63001.8 kDa
EC 编号 ec_number	1.2.99.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MEYIIKNGFVYCPLNNVDGEKMDICVRDGKIVESVSDSAKVIDASGKIVMPGGVDPHSHIAGAKVNVGRMYRPEDSRRDAEKFKAGRAGSGFSVPSTFMTGYRYAQMGYTTAMEAAMPPLLARHTHEEFHDTPIIDHAAYPLFGNNWFVMEYLKEGDVDACAAYASWLLKATKGYTIKIVNPAGTEAWGWGGNVHGIHDPAPYFDITPAEIIKGLAEVNEKLQLPHSIHLHCNDLGHPGNYETTLASFDVPKNIKANPATGERDTVLYATHVQFHSYGGTTWRDFVSEAPKIADYVNKNDHIVIDVGQITLDETTTMTADGPMEYDLHSLNGLKWANCDVELETGSGVVPFIYSARAPVPAVQWAIGMELFLLIDDPAKVCLTTDSPNAGPFTRYPRVIAWLMSNKYRMNLIEGELHKWAQRKSTIATVDREYTFSEIAQITRSTSAKVLGLSETKGHLGVGADADIAVYNINPETVDPSVDYMAIEEGFSRAAYVLKDGEIVVKDGEVVASPHGRTYWVDTRVDESTYNEVLAKVESKFKQYYSVNFANYPVQDEYLPKSAPVKGVML

Entity 8 Entity 8 polymer

Description description	formylmethanofuran dehydrogenase subunit B
Molecular weight formula_weight	48179.8 kDa
EC 编号 ec_number	1.2.7.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MSVYKNVTCPVCGGSCDDIEVLYDGKTIKTRNACRMGNAKFQEMVSSHRILRPQIKTESGFRSAEWDEALDAAAEILTESKRPTLFMGSEMSTEAMAAGLELGEYLNAMVDSNATICHGPTLMGIQEAGQSAATAGEIKNRADVIIYWGTNVMDSMPRHMSRYSIFMRGFFRERGKKDRTVISVDPRETATTKASDIHLQLKPNSDYELFSALLTVIRGNEPHRSIESITGISVETIKEVADIMLNAQFGAIYGGLGLASSEGKHRNVEMVLKLVAALNEHTKFTIGAIRGHCNVAGFNQVASWEYGFPFGVDFTRGYPRYNPGETTIVDLLQRKESDAVLVICSDLGAHLPKECVEYMKEIPVICIDIAPCPTTLVSDVVIPGVIDAMESSGTFYRFDNVPIHHKAFTTSPFPETESNEHTLRQILERVKSIKGE

Entity 9 Entity 9 polymer

Description description	Tungsten formylmethanofuran dehydrogenase, subunit G
Molecular weight formula_weight	8564.9 kDa
EC 编号 ec_number	1.2.99.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MAIGLKAYPELCHGCGNCVIACPVNALRSPEVAGGKGPTDDVEIIMIVEDGVVNIKNPDLCGKCGTCVESCPVDAIRLEELE

Entity 10 Entity 10 polymer

Description description	Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C
Molecular weight formula_weight	43383.2 kDa
EC 编号 ec_number	1.2.7.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

MGFVLVPKSDFQIPLEADTIRPDLFEGLDLDEIRSLQVYEGNIKRPLGEFFEIAETSHEDQLIRIDGDVSRVKYIGSGMKSGKIIINGDVGLQLGCEMKGGEIEVNGNVSSWIGMEMHGGTIKINGNAGDYVGCAYRGEWRGMKGGKIIIQGNAGNNIGGGMMAGEIYIGGDAGNFCGIRMNGGEITVRGDAGRAPGAEMVSGIIKIHGRISSLLPGFKEISTFKEDGSLMILFKGDLSEKNPEGNLYINYNKNLHILENETDEGRVITKKGIKVIYNSGSTIREGQIIKGGNKLTDDYIDECARCCISPEDYKLLGEPENVVVSSHGNEVVLRAVEDPGIQMGTIFIPRGIWANVLTPPYTESTGSPMYKGVPVYLRKASQGERILSAEELVEEYGVGK

Entity 11 Entity 11 polymer

Description description	Polyferredoxin protein MvhB
Molecular weight formula_weight	44090.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MIVVNKEDCIRCGACQGTCPTAAIEVTPEDVIYCDICGGEPKCVDACPTGALKIEDLVVDEAGNTQGRIVFNPDKCNECGDCVEVCPPQILKLDEGKVKKIPLQGFCVMCQKCVDICPVGVIGVEGIKEPAKVELEIEGPIFIADCVGCGMCVPECPVDAITLEKVGGVIEIDEDTCIKCGVCAQTCPWNAVYISGKKPEKRAKEIRKFELDEEACIGCNTCVEACPGDFIVPKSSNLTVELPAICTACGLCEQLCPVDAIDLDVELGPAKPASEEGLVWDEGKCDFIGACANICPNDAIRVVTREGMKLPDNEKVDEEPSFAMCTRCGACTMACPKGALSLVDMDKVIDGEVVKRKRVQYNPALCDQCGDCIEACPYDMLKLTDEKVPLKGFCILCDQCIPACPKGALSLK

Entity 12 Entity 12 polymer

Description description	F420-non-reducing hydrogenase subunit A
Molecular weight formula_weight	52905.1 kDa
EC 编号 ec_number	1.12.99.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MVKLTMEPVTRIEGHAKITVHLDDAGNVEDTRLHVMEFRGFEKFLQGRPIEEAPRIVPRICGICDVQHHLAAAKAVDACFGFEPDDVLPAAYKMREIMNWGSYMHSHGLHFYFLAAPDFIAGKDRKTRNVFQIIKDAPDVALQAIELRKNALEIVRATGGRPIHPTSSTPGGISTELDDETQKDLLQKAQRNVELAEATLELAVPIFEENIDLVNSLGNIETYHTGLVKNGVWDVYDGIVRIKDKEGNLFREFKPADYADTIAEHVKPYSWLKFPYIKDLGYPDGVYRVSPLSRLNVADKMPDAAPKAQDYFKEFQDKFGYAQQTLLYHWARLIEVLACAECAADALEGDLSGEKFPDSLERQAGDGVGIVEAPRGTLTHHYTCDENGLITKANIVVATIQNNPAMEMGIQKVAQDYIKPGVEVDDKIFNLMEMVIRAYDPCLSCATHTIDSQMRLATLEVYDSEGDLVKRI

Entity 13 Entity 13 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	45

Entity 14 Entity 14 non-polymer

Description description	FLAVIN-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	785.5 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 15 Entity 15 non-polymer

Description description	Non-cubane [4Fe-4S]-cluster
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 18 Entity 18 non-polymer

Description description	2-AMINO-5,6-DIMERCAPTO-7-METHYL-3,7,8A,9-TETRAHYDRO-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-4-ONE GUANOSINE DINUCLEOTIDE
Molecular weight formula_weight	740.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 19 Entity 19 non-polymer

Description description	MOLYBDENUM ATOM
Molecular weight formula_weight	95.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 20 Entity 20 non-polymer

Description description	HYDROSULFURIC ACID
Molecular weight formula_weight	34.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	FE3-S4 CLUSTER
Molecular weight formula_weight	295.8 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	formyl[bis(hydrocyanato-1kappaC)]ironnickel(Fe-Ni)
Molecular weight formula_weight	195.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 23 Entity 23 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	343

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	722594

Structure of the Mvh-Hdr-Fmd complex of Methanothermobacter marburgensis (composite structure)

1. Protein Identity and Related Structures Protein Identity & Related Structures

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

H(2):CoB-CoM heterodisulfide,ferredoxin reductase subunit C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F420-non-reducing hydrogenase iron-sulfur subunit D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F420-non-reducing hydrogenase subunit G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tungsten formylmethanofuran dehydrogenase, subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tungsten formylmethanofuran dehydrogenase, subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

formylmethanofuran dehydrogenase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tungsten formylmethanofuran dehydrogenase, subunit G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Molybdenum-containing formylmethanofuran dehydrogenase 1 subunit C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer