SAXSdb — 8unk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein

Methanocaldococcus jannaschii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Regulatory protein Cgi121 × 1 （A0A832SJR9） KEOPS complex Pcc1-like subunit × 1 （I6URN7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KAE1B_METJA
Isoform	—
PDB entities	1, 3
Chains and sequence ranges	Author chain B； PDBConstruct 1–203； UniProt 333–535 Author chain K； PDBConstruct 1–324； UniProt 1–324

Regulatory protein Cgi121

Methanocaldococcus jannaschii

UniProt A0A832SJR9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein × 1 （Q58530） Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein × 1 （Q58530） KEOPS complex Pcc1-like subunit × 1 （I6URN7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A832SJR9_9EURY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 2–146； UniProt 1–145

KEOPS complex Pcc1-like subunit

Pyrococcus furiosus

UniProt I6URN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein × 1 （Q58530） Regulatory protein Cgi121 × 1 （A0A832SJR9） Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein × 1 （Q58530）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I6URN7_9EURY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain P； PDBConstruct 1–82； UniProt 1–82

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8unk
Deposition date deposition_date	2023-10-19
Structure title title	Structure of the KEOPS complex (Cgi121/Bud32/Kae1/Pcc1)
Keywords keywords	tRNA, modification, t6A, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8unk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8unk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8unk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.88 Å
Rg (electron density)	32.43 Å
Total Rg	32.62 Å
Atom count	9862
Residues	691
Excluded volume	90634 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8unk__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein
Molecular weight formula_weight	23957.5 kDa
Mutation mutation	E148R
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	9862

KIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDRDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE

Source Source

Source organism organism	Methanocaldococcus jannaschii
NCBI taxonomy ID ncbi_taxonomy_id	2190
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Regulatory protein Cgi121
Molecular weight formula_weight	16717.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

PMIIRGIRGARINNEIFNLGLKFQILNADVVATKKHVLHAINQAKTKKPIAKSFWMEILVRASGQRQIHEAIKIIGAKDGNVCLICEDEETFRKIYELIGGEIDDSVLEINEDKERLIREIFKIRGFGNVVERVLEKIALIELKKE

Source Source

Source organism organism	Methanocaldococcus jannaschii
NCBI taxonomy ID ncbi_taxonomy_id	2190
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein
Molecular weight formula_weight	35772.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWI

Source Source

Source organism organism	Methanocaldococcus jannaschii
NCBI taxonomy ID ncbi_taxonomy_id	2190
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	KEOPS complex Pcc1-like subunit
Molecular weight formula_weight	9410.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MKAKRVQAKIEIEFPSEDVAKVVYEAVLYEHLSVPYRRSEIDFKLEGKKIILDIKATDSSALRGTVNSYLRWIKAAIDVIEV

Source Source

Source organism organism	Pyrococcus furiosus
NCBI taxonomy ID ncbi_taxonomy_id	2261
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.91 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	386585

Structure of the KEOPS complex (Cgi121/Bud32/Kae1/Pcc1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

Regulatory protein Cgi121

State in the Current Structure

Other States of the Same Protein in the Database

KEOPS complex Pcc1-like subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8unk__assembly_1__model_1

8unk__assembly_1__model_1 | I(q)

8unk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of the KEOPS complex (Cgi121/Bud32/Kae1/Pcc1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Regulatory protein Cgi121

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

KEOPS complex Pcc1-like subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8unk__assembly_1__model_1

8unk__assembly_1__model_1 | I(q)

8unk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)