SAXSdb — 8vgy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis-inducing factor 1, mitochondrial,Mitochondrial intermembrane space import and assembly protein 40

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	FLAVIN-ADENINE DINUCLEOTIDE × 1 1,2-ETHANEDIOL × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	FLAVIN-ADENINE DINUCLEOTIDE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AIFM1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–511； UniProt 104–613 Author chain C； PDBConstruct 2–511； UniProt 104–613

Apoptosis-inducing factor 1, mitochondrial,Mitochondrial intermembrane space import and assembly protein 40

Homo sapiens

UniProt Q8N4Q1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	FLAVIN-ADENINE DINUCLEOTIDE × 1 1,2-ETHANEDIOL × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	FLAVIN-ADENINE DINUCLEOTIDE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MIA40_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 521–565； UniProt 1–45 Author chain C； PDBConstruct 521–565； UniProt 1–45

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8vgy
Deposition date deposition_date	2023-12-29
Structure title title	Crystal structure of human apoptosis-inducing factor (AIF) bound to the fused N-terminal domain of CHCHD4
Keywords keywords	Apoptosis-inducing factor (AIF), CHCHD4, Mia40, oxidoreductase, disulfide relay; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8vgy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8vgy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8vgy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.58 Å
Rg (electron density)	23.43 Å
Total Rg	24.33 Å
Atom count	7267
Residues	473
Excluded volume	64888 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8vgy__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8vgy__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Apoptosis-inducing factor 1, mitochondrial,Mitochondrial intermembrane space import and assembly protein 40
Molecular weight formula_weight	62269.5 kDa
EC 编号 ec_number	1.6.99.-
Mutation mutation	W196A in Apoptosis-inducing factor 1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	14678

MLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDSGSGPGSGSMSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPLEVLFQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	FLAVIN-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	785.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	388

▶

Unit-cell length a length_a	68.608 Å
Unit-cell length b length_b	109.197 Å
Unit-cell length c length_c	174.632 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	92.590 Å
R factor r_factor	0.1825
R_work r_work	0.1810
R_free r_free	0.2117

Crystal structure of human apoptosis-inducing factor (AIF) bound to the fused N-terminal domain of CHCHD4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis-inducing factor 1, mitochondrial,Mitochondrial intermembrane space import and assembly protein 40

State in the Current Structure

Other States of the Same Protein in the Database

Apoptosis-inducing factor 1, mitochondrial,Mitochondrial intermembrane space import and assembly protein 40

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8vgy__assembly_1__model_1

8vgy__assembly_1__model_1 | I(q)

8vgy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of human apoptosis-inducing factor (AIF) bound to the fused N-terminal domain of CHCHD4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis-inducing factor 1, mitochondrial,Mitochondrial intermembrane space import and assembly protein 40

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Apoptosis-inducing factor 1, mitochondrial,Mitochondrial intermembrane space import and assembly protein 40

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8vgy__assembly_1__model_1

8vgy__assembly_1__model_1 | I(q)

8vgy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)