8y9v

ZIKV NS2B/NS3 protease

Method: X-RAY DIFFRACTION D_max: 79.4 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine protease subunit NS2B

Zika virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1411–1462	Not recorded	Serine protease NS3 × 1 （Q32ZE1）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；300 K；PEG 20% 2000, ammonium sulfate 0.2 M, sodium acetate trihydrate 0.1 M	Resolution 1.90 Å R-free 0.248
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 1411–1462	Not recorded	Serine protease NS3 × 1 （Q32ZE1） DAR-LYS-ORN-ARG × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；300 K；PEG 20% 2000, ammonium sulfate 0.2 M, sodium acetate trihydrate 0.1 M	Resolution 1.90 Å R-free 0.248

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8Y9V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5H6V Structure of Zika virus protease in complex with a dipeptide inhibitor Deposited 2016-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1411–1462（52 aa） Fragment：UNP residues 1411-1462 Chain B 1497–1673（177 aa） Fragment：UNP residues 1497-1673	Mutation：R29K	7HS (S)-2-acetamido-6-amino-N-((S)-5-guanidino-1-oxopentan-2-yl)hexanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；2M Ammonium sulfate, 0.1M Sodium acetate trihydrate PH4.6	Resolution 2.42 Å R-free 0.244
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 1497–1673（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1512–1666（155 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1514–1666（153 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1515–1666（152 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1508–1666（159 aa）	Not recorded	E5X 4-(hydroxymethyl)benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6Y3B Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2110 Deposited 2020-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1411–1462（52 aa） Chain B 1497–1673（177 aa）	Not recorded	GOL GLYCEROL × 1 O7N 1-[(8~{R},15~{S},18~{S})-15,18-bis(4-azanylbutyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 2.0 M ammonium sulfate	Resolution 1.59 Å R-free 0.188
7DOC Crystal structure of Zika NS2B-NS3 protease with compound 5 Deposited 2020-12-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1514–1666（153 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 30% Peg 2000	Resolution 1.90 Å R-free 0.229
7O2M Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2289 Deposited 2021-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1411–1462（52 aa） Chain B 1497–1673（177 aa）	Not recorded	UZZ 1-[(3~{S},6~{S},9~{S},19~{R})-3,6-bis(4-azanylbutyl)-2,5,8,12,15,18-hexakis(oxidanylidene)-9-(phenylmethyl)-1,4,7,11,14,17-hexazacyclotricos-19-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 18 % PEG2000	Resolution 1.90 Å R-free 0.251
7VXX Zika virus NS2B/NS3 protease bZipro(C143S) in complex with 4-amino benzamidine Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1411–1462（52 aa） Chain B 1497–1673（177 aa）	Mutation：C143S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.2M ammonium sulfate, 30% polyethylene glycol monomethyl ether 2000, 0.1M sodium acetate trihydrate	Resolution 1.90 Å R-free 0.240
7VXX Zika virus NS2B/NS3 protease bZipro(C143S) in complex with 4-amino benzamidine Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1411–1462（52 aa） Chain D 1497–1673（177 aa）	Mutation：C143S	PBZ P-AMINO BENZAMIDINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.2M ammonium sulfate, 30% polyethylene glycol monomethyl ether 2000, 0.1M sodium acetate trihydrate	Resolution 1.90 Å R-free 0.240
7VXY Zika virus NS2B/NS3 protease bZipro(C143S) in complex with D-RKOR Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1411–1462（52 aa） Chain B 1497–1673（177 aa）	Mutation：C143S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.2M ammonium sulfate, 30% polyethylene glycol monomethyl ether 2000, 0.1M sodium acetate trihydrate	Resolution 1.90 Å R-free 0.251
7VXY Zika virus NS2B/NS3 protease bZipro(C143S) in complex with D-RKOR Deposited 2021-11-13	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1411–1462（52 aa） Chain D 1497–1673（177 aa）	Mutation：C143S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.2M ammonium sulfate, 30% polyethylene glycol monomethyl ether 2000, 0.1M sodium acetate trihydrate	Resolution 1.90 Å R-free 0.251

9 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	H8XX12_ZIKV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–53； UniProt 1411–1462 Author chain C； PDBConstruct 2–53； UniProt 1411–1462

Serine protease NS3

Zika virus

UniProt Q32ZE1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1516–1668	Not recorded	Serine protease subunit NS2B × 1 （H8XX12）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；300 K；PEG 20% 2000, ammonium sulfate 0.2 M, sodium acetate trihydrate 0.1 M	Resolution 1.90 Å R-free 0.248
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain D； UniProt 1511–1671	Not recorded	Serine protease subunit NS2B × 1 （H8XX12） DAR-LYS-ORN-ARG × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；300 K；PEG 20% 2000, ammonium sulfate 0.2 M, sodium acetate trihydrate 0.1 M	Resolution 1.90 Å R-free 0.248

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8Y9V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
29HN Crystal structure of Zika virus NS2B-NS3 protease determined via sulfur phasing Deposited 2026-03-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；293.15 K；0.1 M sodium acetate, pH 4.8, 0.2 M ammonium sulfate, 30 % w/v PEG2000	Resolution 1.77 Å R-free 0.265
5JPS Structure of the Zika Virus NS3 Helicase Domain Deposited 2016-05-04	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1674–2115（442 aa） Fragment：UNP residues 1674-2115	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；8% Tacsimate 6.0, 20% PEG 3350	Resolution 1.78 Å R-free 0.215
5K6K Zika virus non-structural protein 1 (NS1) Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 790–1142（353 aa） Chain B 790–1142（353 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SO4 SULFATE ION × 5 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；25% PEG 3350 150 mM NH3SO4 100 mM tris 8.5	Resolution 1.89 Å R-free 0.189
5K6K Zika virus non-structural protein 1 (NS1) Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 790–1142（353 aa） Chain B 790–1142（353 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 SO4 SULFATE ION × 10 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；25% PEG 3350 150 mM NH3SO4 100 mM tris 8.5	Resolution 1.89 Å R-free 0.189
5K6K Zika virus non-structural protein 1 (NS1) Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 790–1142（353 aa） Chain B 790–1142（353 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 SO4 SULFATE ION × 10 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；25% PEG 3350 150 mM NH3SO4 100 mM tris 8.5	Resolution 1.89 Å R-free 0.189
5RHG PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z235341991 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 3 NY7 N-(2-methoxy-5-methylphenyl)glycinamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.41 Å R-free 0.205
5RHH PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1515654336 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UQJ 3-(difluoromethyl)-1-methyl-1H-pyrazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.59 Å R-free 0.215
5RHI PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z198194396 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 K2M 4-(furan-2-carbonyl)piperazine-1-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.45 Å R-free 0.212
5RHJ PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z126932614 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 T6J 2-[(methylsulfonyl)methyl]-1H-benzimidazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.50 Å R-free 0.208
5RHK PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z87615031 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UQM N-[4-(2-amino-2-oxoethyl)phenyl]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.52 Å R-free 0.206
5RHL PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z425387594 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 H04 1-(2-ethoxyphenyl)piperazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.43 Å R-free 0.227
5RHM PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1454310449 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UQS N-[(2-fluorophenyl)methyl]-1H-pyrazol-4-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.68 Å R-free 0.215
5RHO PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1444783243 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UQV [2-(acetylamino)phenyl]acetic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.49 Å R-free 0.211
5RHP PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z2856434938 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 7ZC 1-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-methanamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.61 Å R-free 0.211
5RHQ PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z235449082 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 JFS [4-(1H-benzimidazol-1-yl)phenyl]methanol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.49 Å R-free 0.212
5RHR PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1348559502 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UQY 1-(methylamino)cyclopentane-1-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.46 Å R-free 0.210
5RHS PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z274555794 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 NZ4 N-(3-acetylphenyl)morpholine-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.53 Å R-free 0.209
5RHT PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z291279160 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 LV4 1-[2-(trifluoromethyloxy)phenyl]thiourea × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.63 Å R-free 0.220
5RHU PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1703168683 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UR7 1-(3-fluoro-4-methylphenyl)methanesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.61 Å R-free 0.215
5RHV PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z62645406 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UR4 2-methoxy-N-(4-phenyl-1,3-thiazol-2-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.71 Å R-free 0.213
5RHW PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z31222641 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 GV1 ~{N},~{N},5,6-tetramethylthieno[2,3-d]pyrimidin-4-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.62 Å R-free 0.210
5RHX PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1324080698 Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 UR1 3-fluoro-5-methylbenzene-1-sulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.73 Å R-free 0.234
5RHY PanDDA analysis group deposition of ground-state model of Zika Virus NS3 Helicase Deposited 2020-05-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K	Resolution 1.36 Å R-free 0.205
5T1V Crystal structure of Zika virus NS2B-NS3 protease in apo-form. Deposited 2016-08-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1467（54 aa） Chain A 1499–1685（187 aa） Chain B 1414–1467（54 aa） Chain B 1499–1685（187 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；292 K；Protein: 12.8mg/ml, 1M Sodium chloride, 0.05M Tris-HCl pH=8.5; Scrren: Classics II (H3), 0.24M Sodium malonate pH=7.0, 20% (w/v) PEG 3350	Resolution 3.10 Å R-free 0.288
5TFN CRYSTAL STRUCTURE OF THE ZIKA VIRUS NS2B-NS3 PROTEASE in super-open conformation Deposited 2016-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1499–1680（182 aa）	Mutation：S135A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.6 mM protein, in 100 mM NaCl, 1.0 mM TCEP, 20 mM Tris-Cl buffer (pH 8.0) was mixed with the well solution (25% PEG3330, 200 mM NaCl and 100 mM BisTris pH 6.5)	Resolution 3.00 Å R-free 0.259
5TFN CRYSTAL STRUCTURE OF THE ZIKA VIRUS NS2B-NS3 PROTEASE in super-open conformation Deposited 2016-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1499–1680（182 aa）	Mutation：S135A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.6 mM protein, in 100 mM NaCl, 1.0 mM TCEP, 20 mM Tris-Cl buffer (pH 8.0) was mixed with the well solution (25% PEG3330, 200 mM NaCl and 100 mM BisTris pH 6.5)	Resolution 3.00 Å R-free 0.259
5TFN CRYSTAL STRUCTURE OF THE ZIKA VIRUS NS2B-NS3 PROTEASE in super-open conformation Deposited 2016-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1499–1680（182 aa） Chain B 1499–1680（182 aa）	Mutation：S135A Mutation：S135A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.6 mM protein, in 100 mM NaCl, 1.0 mM TCEP, 20 mM Tris-Cl buffer (pH 8.0) was mixed with the well solution (25% PEG3330, 200 mM NaCl and 100 mM BisTris pH 6.5)	Resolution 3.00 Å R-free 0.259
5TFO CRYSTAL STRUCTURE OF THE ZIKA VIRUS NS2B-NS3 PROTEASE with a deletion V76-L86 in NS2b Deposited 2016-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1416–1443（28 aa） Chain A 1499–1680（182 aa）	Mutation：V76-L86 substituted with GG,V76-L86 substituted with GG,V76-L86 substituted with GG Mutation：V76-L86 substituted with GG,V76-L86 substituted with GG,V76-L86 substituted with GG	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.6 mM protein, in 100 mM NaCl, 1.0 mM TCEP, 20 mM Tris-Cl buffer (pH 8.0) was mixed with the well solution (25% PEG3330, 200 mM NaCl and 100 mM BisTris pH 6.5)	Resolution 2.51 Å R-free 0.250
5TFO CRYSTAL STRUCTURE OF THE ZIKA VIRUS NS2B-NS3 PROTEASE with a deletion V76-L86 in NS2b Deposited 2016-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1416–1443（28 aa） Chain B 1499–1680（182 aa）	Mutation：V76-L86 substituted with GG,V76-L86 substituted with GG,V76-L86 substituted with GG Mutation：V76-L86 substituted with GG,V76-L86 substituted with GG,V76-L86 substituted with GG	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.6 mM protein, in 100 mM NaCl, 1.0 mM TCEP, 20 mM Tris-Cl buffer (pH 8.0) was mixed with the well solution (25% PEG3330, 200 mM NaCl and 100 mM BisTris pH 6.5)	Resolution 2.51 Å R-free 0.250
5TFR Crystal structure of Zika Virus NS5 protein Deposited 2016-09-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2517–3419（903 aa）	Not recorded	SAH S-ADENOSYL-L-HOMOCYSTEINE × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；290 K；0.1 M sodium cacodylate, pH 6.5, 0.6 M trisodium citrate	Resolution 3.05 Å R-free 0.237
5TFR Crystal structure of Zika Virus NS5 protein Deposited 2016-09-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2517–3419（903 aa）	Not recorded	SAH S-ADENOSYL-L-HOMOCYSTEINE × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；290 K；0.1 M sodium cacodylate, pH 6.5, 0.6 M trisodium citrate	Resolution 3.05 Å R-free 0.237
5U0B Structure of full-length Zika virus NS5 Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2517–3419（903 aa）	Not recorded	SAH S-ADENOSYL-L-HOMOCYSTEINE × 1 ZN ZINC ION × 2 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；277 K；1.0 M ammonium sulfate plus 1% PE G 3350, 0.1 M Bis-Tris, pH 5.5	Resolution 3.00 Å R-free 0.268
5U0B Structure of full-length Zika virus NS5 Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2517–3419（903 aa）	Not recorded	SAH S-ADENOSYL-L-HOMOCYSTEINE × 1 ZN ZINC ION × 2 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.5；277 K；1.0 M ammonium sulfate plus 1% PE G 3350, 0.1 M Bis-Tris, pH 5.5	Resolution 3.00 Å R-free 0.268
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5U0C Structure of Zika virus NS5 RNA polymerase domain Deposited 2016-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 2781–3419（639 aa） Fragment：residues 2781-3419	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；277 K；0.1 M Tris pH 7.5, 0.2 M sodium citrate, and 17% PEG 3350	Resolution 3.00 Å R-free 0.260
5VI7 Crystal structure of the Zika virus NS3 helicase Deposited 2017-04-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1677–2115（439 aa）	Not recorded	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；288 K；PEG 400, cacodylate, lithium sulfate	Resolution 2.00 Å R-free 0.207
5W41 Zika MR766 NLS in complex with Importin alpha subunit-1 Deposited 2017-06-08	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2887–2923（37 aa） Fragment：unp residues 2887-2923	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；1M Sodium citrate, 0.01M DTT, pH6.5	Resolution 2.20 Å R-free 0.203
5Y4Z Crystal structure of the Zika virus NS3 helicase complex with AMPPNP Deposited 2017-08-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1676–2115（440 aa） Fragment：UNP RESIDUES 1676-2115	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；8% Tacsimate 6.0, 20% PEG 3350	Resolution 1.30 Å R-free 0.216
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMQ Crystal structure of Zika NS3 protease with phenylacetyl-Lys-Lys-Arg-COOH inhibitor Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.99 Å R-free 0.201
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZMS Crystal structure of Zika NS3 protease in complex with 4-guanidinomethyl-phenylacetyl-Lys-Lys-Arg-H Deposited 2018-04-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 1.80 Å R-free 0.252
5ZOB Crystal structure of Zika NS3 protease with 4-guanidinomethyl-phenylacetyl-Arg-Arg-Arg-4-amidinobenzylamide Deposited 2018-04-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1414–1464（51 aa） Chain G 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 2.00 Å R-free 0.279
5ZOB Crystal structure of Zika NS3 protease with 4-guanidinomethyl-phenylacetyl-Arg-Arg-Arg-4-amidinobenzylamide Deposited 2018-04-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1414–1464（51 aa） Chain E 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；2 M ammonium sulfate, 0.1 M sodium acetate trihydrate pH 4.6	Resolution 2.00 Å R-free 0.279
6ADW Crystal structure of the Zika virus NS3 helicase (apo form) Deposited 2018-08-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1679–2115（437 aa）	Not recorded	SO4 SULFATE ION × 3 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；289 K；PEG3350, lithium sulfate	Resolution 2.20 Å R-free 0.216
6ADX Crystal structure of the Zika virus NS3 helicase (ADP-Mn2+ complex, form 1) Deposited 2018-08-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1679–2115（437 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；PEG3350, lithium sulfate	Resolution 1.75 Å R-free 0.211
6ADY Crystal structure of the Zika virus NS3 helicase (ADP-Mn2+ complex, form 2) Deposited 2018-08-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1679–2115（437 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；PEG3350, lithium sulfate	Resolution 1.90 Å R-free 0.226
6JPW Crystal structure of Zika NS2B-NS3 protease with compound 1C Deposited 2019-03-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 25% Peg 4000	Resolution 1.95 Å R-free 0.205
6JPW Crystal structure of Zika NS2B-NS3 protease with compound 1C Deposited 2019-03-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 25% Peg 4000	Resolution 1.95 Å R-free 0.205
6JPW Crystal structure of Zika NS2B-NS3 protease with compound 1C Deposited 2019-03-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 25% Peg 4000	Resolution 1.95 Å R-free 0.205
6JPW Crystal structure of Zika NS2B-NS3 protease with compound 1C Deposited 2019-03-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 25% Peg 4000	Resolution 1.95 Å R-free 0.205
6KK2 Crystal structure of Zika NS2B-NS3 protease with compound 2 Deposited 2019-07-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	D9U 1-[(10~{S},17~{S},20~{S})-17,20-bis(4-azanylbutyl)-4,9,16,19,22-pentakis(oxidanylidene)-3,8,15,18,21-pentazabicyclo[22.2.2]octacosa-1(27),24(28),25-trien-10-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium acetate trihydrate 4.6, 25% PEG 4000	Resolution 2.02 Å R-free 0.256
6KK3 Crystal structure of Zika NS2B-NS3 protease with compound 4 Deposited 2019-07-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1418–1455（38 aa）	Not recorded	DUU 1-[(10~{R},17~{S},20~{S})-17,20-bis(4-azanylbutyl)-4,9,16,19,22-pentakis(oxidanylidene)-3,8,15,18,21-pentazabicyclo[22.2.2]octacosa-1(26),24,27-trien-10-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 30% Peg 2000	Resolution 2.05 Å R-free 0.217
6KK4 Crystal structure of Zika NS2B-NS3 protease with compound 9 Deposited 2019-07-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	DE0 1-[(9~{R},16~{S},19~{S})-16,19-bis(4-azanylbutyl)-4,8,15,18,21-pentakis(oxidanylidene)-3,7,14,17,20-pentazabicyclo[21.3.1]heptacosa-1(26),23(27),24-trien-9-yl]guanidine × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 25% Peg 4000	Resolution 1.74 Å R-free 0.184
6KK5 Crystal structure of Zika NS2B-NS3 protease with compound 15 Deposited 2019-07-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	DE6 1-[(5~{S},8~{R},15~{S},18~{S})-15,18-bis(4-azanylbutyl)-5-methyl-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6	Resolution 2.03 Å R-free 0.231
6KK6 Crystal structure of Zika NS2B-NS3 protease with compound 16 Deposited 2019-07-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	SO4 SULFATE ION × 1 GOL GLYCEROL × 1 DV0 1-[(5~{R},8~{R},15~{S},18~{S})-15,18-bis(4-azanylbutyl)-5-methyl-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；2M Ammonium Sulfate, 5% Propanol	Resolution 1.74 Å R-free 0.181
6KPQ Crystal structure of Zika NS2B-NS3 protease with compound 8 Deposited 2019-08-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	DT0 1-[(10~{R},17~{S},20~{S})-17,20-bis(4-azanylbutyl)-4,9,16,19,22-pentakis(oxidanylidene)-3,8,15,18,21-pentazabicyclo[22.3.1]octacosa-1(27),24(28),25-trien-10-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 30% Peg 2000	Resolution 2.62 Å R-free 0.246
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1418–1455（38 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1419–1455（37 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1418–1455（38 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6L4Z Crystal structure of Zika NS2B-NS3 protease with compound 6 Deposited 2019-10-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1418–1457（40 aa）	Not recorded	E5X 4-(hydroxymethyl)benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.90 Å R-free 0.226
6L50 Crystal structure of Zika NS2B-NS3 protease with compound 16 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.95 Å R-free 0.235
6L50 Crystal structure of Zika NS2B-NS3 protease with compound 16 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.95 Å R-free 0.235
6L50 Crystal structure of Zika NS2B-NS3 protease with compound 16 Deposited 2019-10-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1414–1464（51 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.95 Å R-free 0.235
6L50 Crystal structure of Zika NS2B-NS3 protease with compound 16 Deposited 2019-10-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1414–1464（51 aa）	Not recorded	E60 2-sulfanylidene-1,3-thiazolidin-4-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000	Resolution 1.95 Å R-free 0.235
6MH3 The crystal structure of Zika virus NS3 helicase domain Deposited 2018-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；291 K；11.5% PEG 1000 11.5% PEG 3350 11.5% MPD 0.09 M NPS 0.1 M MES-imidazole pH 6.7	Resolution 1.92 Å R-free 0.203
6UX2 Crystal structure of ZIKV RdRp in complex with STAT2 Deposited 2019-11-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2789–3419（631 aa）	Not recorded	SO4 SULFATE ION × 4 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298.15 K；0.2 M ammonium sulfate, 11% PEG 8000 and 0.1 M Tris-HCl, pH 8.5	Resolution 3.01 Å R-free 0.264
7DOC Crystal structure of Zika NS2B-NS3 protease with compound 5 Deposited 2020-12-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1418–1455（38 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 30% Peg 2000	Resolution 1.90 Å R-free 0.229
7DOC Crystal structure of Zika NS2B-NS3 protease with compound 5 Deposited 2020-12-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1419–1457（39 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 30% Peg 2000	Resolution 1.90 Å R-free 0.229
7G9K PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1262246195 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 S7A 3,3,3-tris(fluoranyl)-1-piperazin-1-yl-propan-1-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.55 Å R-free 0.239
7G9L PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z111782404 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZTQ (2S)-2-[([1,1'-biphenyl]-4-yl)oxy]propanoic acid × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.54 Å R-free 0.224
7G9M PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z44584886 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 AWD ~{N}-(4-fluorophenyl)-4-methyl-piperazine-1-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.54 Å R-free 0.241
7G9N PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z57821475 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZU7 N-(4-fluorophenyl)-2-(piperazin-1-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.42 Å R-free 0.229
7G9O PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z133716556 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 Z3H N-[(4R)-3,4-dihydro-2H-1-benzopyran-4-yl]methanesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.93 Å R-free 0.262
7G9P PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1619958679 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZUC 3-fluoro-N-(2-hydroxy-6-methylphenyl)pyridine-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.74 Å R-free 0.232
7G9Q PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z751811134 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZUG N,N-dimethylpyridine-3-sulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 2.13 Å R-free 0.285
7G9R PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z385450668 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 LL0 2-(difluoromethoxy)benzene-1-sulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.80 Å R-free 0.251
7G9S PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z758198920 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZUW 1-(2,3-dihydro-1,4-benzoxazepin-4(5H)-yl)ethan-1-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 2.09 Å R-free 0.270
7G9T PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z18618496 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 ZUZ methyl N-(cyclohexanecarbonyl)glycinate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.90 Å R-free 0.258
7G9U PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z55222357 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZV2 2-(2-azanyl-1,3-thiazol-3-yl)-~{N}-(4-fluorophenyl)ethanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.69 Å R-free 0.226
7G9V PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z383202616 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 LHR N-(1H-indazol-6-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.74 Å R-free 0.228
7G9W PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z444860982 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 8C2 N-[(3,5-dimethyl-1H-pyrazol-4-yl)methyl]cyclohexanamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.85 Å R-free 0.267
7G9X PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z905065822 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZV5 (5R)-1,3,7-triazaspiro[4.5]decane-2,4-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.81 Å R-free 0.282
7G9Y PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z2678251369 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 1 ZV8 2-tert-butyl-5,6,7,8-tetrahydropyrido[4,3-d]pyrimidine × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.83 Å R-free 0.242
7G9Z PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1216822028 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZVB 2-(propan-2-yl)-1H-pyrrolo[3,2-b]pyridine × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.62 Å R-free 0.212
7GA0 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z2048325751 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZVE (3R)-3-[1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl]piperidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.97 Å R-free 0.254
7GA1 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with POB0128 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 1 ZVH (1S,2R)-2-(thiophen-3-yl)cyclopentane-1-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 2.09 Å R-free 0.250
7GA2 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with POB0008 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 YEK methyl 1-(methanesulfonyl)-2-methyl-D-prolinate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 2.03 Å R-free 0.276
7GA3 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z3241250482 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 HV2 1,1-bis(oxidanylidene)thietan-3-ol × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.81 Å R-free 0.253
7GA4 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z56823075 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZVK ethyl N'-(4-ethylphenyl)-N-methylcarbamimidothioate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.75 Å R-free 0.230
7GA5 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z119989094 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZVN 2-(piperazin-1-yl)-1,3-benzothiazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.84 Å R-free 0.255
7GA6 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1509711879 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 YFR 6-bromo-7-hydroxy-2,2-dimethyl-2H,4H-1,3-benzodioxin-4-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.75 Å R-free 0.231
7GA7 PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z85933875 Deposited 2023-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa） Fragment：HELICASE DOMAIN	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 ZW5 1-[(3-fluoro-4-methoxyphenyl)methyl]piperazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.42 Å R-free 0.216
7H1H PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1201620232 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 NZ1 5-methoxy-1,3-benzothiazol-2-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.68 Å R-free 0.300
7H1I PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z336080990 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 VWJ N-(propan-2-yl)-1H-benzimidazol-2-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.41 Å R-free 0.247
7H1J PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z68299550 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 JOV 3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.55 Å R-free 0.270
7H1K PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z57122377 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 9 ELQ [3,4-bis(fluoranyl)phenyl]-(4-methylpiperazin-1-yl)methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.50 Å R-free 0.254
7H1L PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with POB0087 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJM (3S)-3-(4-fluorophenyl)piperidine-3-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.53 Å R-free 0.271
7H1M PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with POB0075 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJN 1-[1-(pyridin-2-yl)cyclopentyl]methanamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.61 Å R-free 0.275
7H1N PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with POB0120 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 6 U4C (2S)-1',4'-dihydro-2'H-spiro[pyrrolidine-2,3'-quinolin]-2'-one × 1 W2M (2R)-1',4'-dihydro-2'H-spiro[pyrrolidine-2,3'-quinolin]-2'-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.41 Å R-free 0.254
7H1O PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1962142017 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 9OI 1,3-oxazol-4-ylmethanamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.41 Å R-free 0.243
7H1P PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z425338146 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 US7 1-[4-(methylsulfonyl)phenyl]piperazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.38 Å R-free 0.253
7H1Q PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z119990326 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1AJO 5-(thiophen-2-yl)-4H-1,2,4-triazol-3-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.41 Å R-free 0.249
7H1R PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z270758780 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJP 4-(aminomethyl)-N,N-dimethylpyridin-2-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.52 Å R-free 0.249
7H1S PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z57477251 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJQ 4-(piperazin-1-yl)quinoline × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.38 Å R-free 0.245
7H1T PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z362020366 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 W3S [1,2,4]triazolo[4,3-a]pyridin-3-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.42 Å R-free 0.253
7H1U PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z212053854 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1AJR 1,2,3,4-tetrahydro-1,5-naphthyridine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.37 Å R-free 0.249
7H1V PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z31113727 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1AJS 1-(pyridin-2-yl)piperidin-4-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.36 Å R-free 0.243
7H1W PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z270834034 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJT (2R)-2-(6,7-dihydrothieno[3,2-c]pyridin-5(4H)-yl)propan-1-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.40 Å R-free 0.241
7H1X PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z53833304 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 T6R 1-ethyl-1H-benzimidazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.40 Å R-free 0.250
7H1Y PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z57493554 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 NNK 4-(aminomethyl)-1-methylpyridinium × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.37 Å R-free 0.248
7H1Z PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1198149728 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJU 4-ethenyl-1H-imidazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.38 Å R-free 0.237
7H20 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z4605084899 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	SO4 SULFATE ION × 2 DMS DIMETHYL SULFOXIDE × 3 A1AJV 3-ethenyl-1,2-dimethyl-pyrazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.39 Å R-free 0.246
7H21 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1269221363 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJY 3-ethenyl-1-methyl-pyridine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.46 Å R-free 0.260
7H22 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1102357527 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	YX6 N-[(3R)-6-oxopiperidin-3-yl]-1,3-thiazole-4-carboxamide × 2 DMS DIMETHYL SULFOXIDE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.55 Å R-free 0.266
7H23 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1148747945 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 WKY N-(3-methylpyridin-4-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.49 Å R-free 0.263
7H24 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1165350851 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJZ 4-(2-hydroxyethyl)-5-methyl-1,2-dihydro-3H-pyrazol-3-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.64 Å R-free 0.267
7H25 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1198158918 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 K4R 1H-indazole-3-carbonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.56 Å R-free 0.265
7H26 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1198317053 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1AJ0 (5-methyl-1H-pyrazolo[3,4-b]pyridin-1-yl)acetic acid × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.85 Å R-free 0.284
7H27 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1203191681 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 5 A1AJ1 N-[(1H-imidazol-2-yl)methyl]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.35 Å R-free 0.242
7H28 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1216833237 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJ2 N-methylisoquinolin-1-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.80 Å R-free 0.249
7H29 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1269184613 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 Z2F 1,3-benzothiazole-6-sulfonamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.77 Å R-free 0.287
7H2A PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1269220427 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 Z2Z 8-(methanesulfonyl)quinoline × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.71 Å R-free 0.277
7H2B PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1272517105 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 9 A1AJ3 {(1S,2S)-1-methyl-2-[(3-methyl-1,2,4-thiadiazol-5-yl)amino]cyclopentyl}methanol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.60 Å R-free 0.253
7H2C PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1328968520 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 J4Q 4-[(2-methylsulfonylimidazol-1-yl)methyl]-1,3-thiazole × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.40 Å R-free 0.249
7H2D PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1397964787 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 GWP 2-cyclopropyl-1~{H}-imidazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.57 Å R-free 0.281
7H2E PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1428159350 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1AJ5 (1S)-1-(1-phenyl-1H-1,2,3-triazol-4-yl)ethan-1-amine × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.36 Å R-free 0.255
7H2F PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1491215378 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1AJ6 N-(piperidin-4-yl)methanesulfonamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.38 Å R-free 0.242
7H2G PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1509195674 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 ZA9 4-[(3S)-piperidin-3-yl]-1H-indole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.25 Å R-free 0.230
7H2H PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1575274523 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1AJ4 [(3aR,7aS)-3a,4,5,6,7,7a-hexahydro-1H-1,3-benzimidazol-2-yl]acetonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.42 Å R-free 0.248
7H2I PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1587220559 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 T1J 2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.32 Å R-free 0.244
7H2J PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1787627869 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 K07 5-chloro-N-methyl-N-{[(3R)-oxolan-3-yl]methyl}pyrimidin-4-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.76 Å R-free 0.292
7H2K PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z18769001 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1AJ7 (2S)-2-(2-cyanophenoxy)propanamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.59 Å R-free 0.267
7H2L PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z19755216 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 TT3 2-(3-fluorophenoxy)-N,N-dimethylacetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.37 Å R-free 0.238
7H2M PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z228586974 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1AJ8 (3-fluorophenyl)(piperazin-1-yl)methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.71 Å R-free 0.286
7H2N PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z228587394 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1AJ9 4-methoxy-2-(piperazin-1-yl)pyrimidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.73 Å R-free 0.260
7H2O PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z234898257 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 UWD N-methyl-1-([1,2,4]triazolo[4,3-a]pyridin-3-yl)methanamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.71 Å R-free 0.260
7H2P PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z2509342103 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	A1AKA (8S)-3-methyl-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrazine × 2 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.45 Å R-free 0.239
7H2Q PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z270760338 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1AKB N,N-dimethylpiperazine-1-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.53 Å R-free 0.270
7H2R PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z31735562 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 6 GWA ~{N}-(3-acetamidophenyl)-2-methoxy-ethanamide × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.32 Å R-free 0.241
7H2S PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z396117078 Deposited 2024-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1AKC N-(1-methyl-1H-pyrazol-4-yl)-2-(trifluoromethyl)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.57 Å R-free 0.267
7HOJ PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1269184291 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1BG6 3-bromanyl-1-methyl-pyridine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.39 Å R-free 0.250
7HOK PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1272480091 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 O2J (2R)-2-(methoxymethyl)-4-(pyridin-2-yl)morpholine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.55 Å R-free 0.288
7HOL PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z1619958679 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 ZUC 3-fluoro-N-(2-hydroxy-6-methylphenyl)pyridine-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.32 Å R-free 0.237
7HOM PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Z2048325751 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1BGH (3R)-3-[1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl]piperidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.48 Å R-free 0.263
7HOO PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014643-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1BGX (2P)-2-(5-methoxypyridin-3-yl)-N-(1-methyl-1H-pyrazol-4-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.49 Å R-free 0.284
7HOP PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014657-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 5 A1BGY 5-cyclopropyl-1,2-dimethyl-N-(3-methylpyridin-4-yl)-1H-pyrrole-3-carboxamide × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.50 Å R-free 0.280
7HOQ PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014708-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BGZ (2M)-2-[2-(methoxymethyl)pyridin-4-yl]-N-(1-methyl-1H-pyrazol-4-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.43 Å R-free 0.260
7HOR PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014712-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BG0 (2P)-2-(2-methoxypyridin-4-yl)-N-(1-methyl-1H-pyrazol-4-yl)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.81 Å R-free 0.267
7HOS PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014657-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BGY 5-cyclopropyl-1,2-dimethyl-N-(3-methylpyridin-4-yl)-1H-pyrrole-3-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.60 Å R-free 0.292
7HOT PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014668-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 6 A1BG2 N-(3-methylpyridin-4-yl)-3-(1,3-thiazol-2-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.59 Å R-free 0.287
7HOU PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014704-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BG3 (2P)-2-(6-fluoro-5-methylpyridin-3-yl)-N-(1-methyl-1H-pyrazol-4-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.48 Å R-free 0.283
7HOV PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014707-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BGM 3-chloro-5-[({2-[(dimethylamino)methyl]-1,3-thiazol-4-yl}methyl)amino]-N-(1-hydroxy-2-methylpropan-2-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.69 Å R-free 0.276
7HOW PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014812-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BGL N-[2-(methanesulfonyl)-5-(piperazin-1-yl)phenyl]quinoline-5-carboxamide × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.45 Å R-free 0.288
7HOX PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014821-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BGK (2P)-2-(6-methoxypyridin-3-yl)-N-(1-methyl-1H-pyrazol-4-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.67 Å R-free 0.281
7HOY PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014767-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BGJ 3-chloro-5-[(E)-({3-[(dimethylamino)methyl]-4-hydroxyphenyl}methylidene)amino]-N-(1-hydroxy-2-methylpropan-2-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.66 Å R-free 0.287
7HOZ PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014795-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BGI N-(1-methyl-1H-pyrazol-4-yl)quinoline-5-carboxamide × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.58 Å R-free 0.311
7HP0 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014812-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 5 A1BGL N-[2-(methanesulfonyl)-5-(piperazin-1-yl)phenyl]quinoline-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.91 Å R-free 0.292
7HP1 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014738-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BG8 N-(1-methyl-1H-pyrazol-4-yl)-2-(2-methylpyrimidin-5-yl)benzamide × 1 SO4 SULFATE ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.84 Å R-free 0.269
7HP2 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014767-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 10 A1BHC 3-chloro-5-[({3-[(dimethylamino)methyl]-4-hydroxyphenyl}methyl)amino]-N-(1-hydroxy-2-methylpropan-2-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.54 Å R-free 0.296
7HP3 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014790-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BHB N-[(8S)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrazin-3-yl]quinoline-5-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.84 Å R-free 0.280
7HP4 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014856-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 5 A1BG4 (2M)-2-[6-(methylamino)pyridin-3-yl]-N-(1-methyl-1H-pyrazol-4-yl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.48 Å R-free 0.297
7HP5 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014897-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BHA 4-methoxy-2-(piperazin-1-yl)-6-{[(pyrimidin-5-yl)oxy]methyl}pyrimidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.00 Å R-free 0.283
7HP6 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014903-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 5 A1BG5 (4R)-2-methyl-N-(3-methylpyridin-4-yl)imidazo[1,2-a]pyridine-7-carboxamide × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.61 Å R-free 0.299
7HP7 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014939-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 5 A1BGN (8S)-7-{[6-methoxy-2-(piperazin-1-yl)pyrimidin-4-yl]methoxy}-5-methyl[1,2,4]triazolo[1,5-a]pyrimidine × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.86 Å R-free 0.286
7HP8 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014942-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BGO N-(3-methylpyridin-4-yl)-5-propanamidopyridine-3-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.74 Å R-free 0.294
7HP9 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015097-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1BGP {2-[(3R)-piperidin-3-yl]-1,3-thiazol-4-yl}[(3S)-3-(pyridin-3-yl)pyrrolidin-1-yl]methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.16 Å R-free 0.317
7HPA PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015164-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	SO4 SULFATE ION × 2 DMS DIMETHYL SULFOXIDE × 5 A1BGQ N-[(2S)-3-[4-(aminomethyl)phenyl]-1-oxo-1-(piperidin-1-yl)propan-2-yl]benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.58 Å R-free 0.273
7HPB PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015080-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1BGR N-{3-chloro-5-[(1-hydroxy-2-methylpropan-2-yl)carbamoyl]phenyl}-2-methyl-3-oxo-2,3-dihydro-1,2-oxazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.16 Å R-free 0.280
7HPC PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015093-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BGW 4-methyl-N-[(2-methyl-1H-imidazol-4-yl)methyl]-2-[(3S)-piperidin-3-yl]-1H-imidazole-5-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.10 Å R-free 0.286
7HPD PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015216-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	A1BGV N-(5-carbamoyl-1H-pyrrol-3-yl)-2-[(propan-2-yl)amino]-1H-1,3-benzimidazole-6-carboxamide × 1 DMS DIMETHYL SULFOXIDE × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.63 Å R-free 0.270
7HPE PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015259-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1BGU N-(1-methyl-1H-pyrazol-4-yl)-2-[(propan-2-yl)amino]-1H-1,3-benzimidazole-6-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.02 Å R-free 0.281
7HPF PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015286-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1BG9 4-methyl-2-[(3S)-piperidin-3-yl]-N-(pyridin-2-yl)-1H-imidazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.95 Å R-free 0.325
7HPG PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015487-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BGT N-(3-methylpyridin-4-yl)-2-oxo-1-{[(3R)-pyrrolidin-3-yl]methyl}-1,2-dihydropyridine-3-carboxamide × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.66 Å R-free 0.289
7HPH PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015442-001 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1BGS 4-methoxy-2-(piperazin-1-yl)-6-{[2-(piperazin-1-yl)pyridin-4-yl]methyl}pyrimidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.34 Å R-free 0.292
7I1K PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0011172-001-002 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BXC 5-chloroquinolin-2-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.13 Å R-free 0.289
7I1L PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0000865-003-002 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 4 A1BXE N-(5-amino-2-methylphenyl)-3-methylbenzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.81 Å R-free 0.313
7I1M PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0011177-001-002 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BXF 7,8-dichloro-2-methylquinolin-4-amine × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.01 Å R-free 0.281
7I1N PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0011710-001-001 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BXG (5P)-8-methyl-5-(2-methyl-1H-imidazol-4-yl)quinoline × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.77 Å R-free 0.292
7I1O PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0011739-001-002 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BXH 8-chloroquinolin-4-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.13 Å R-free 0.311
7I1P PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0011741-001-001 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	SO4 SULFATE ION × 1 DMS DIMETHYL SULFOXIDE × 5 A1BXI 2-[(2,8-dimethylquinolin-4-yl)oxy]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.99 Å R-free 0.306
7I1Q PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0011753-001-001 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BXJ ethyl 4-amino-8-cyanoquinoline-3-carboxylate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.73 Å R-free 0.313
7I1S PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0012445-001-001 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 5 A1BXL N-(quinolin-8-yl)piperidine-4-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.86 Å R-free 0.322
7I1T PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0012466-002-003 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BXM N-[4-(hydroxymethyl)-2-methylquinolin-8-yl]piperidine-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.86 Å R-free 0.286
7I1V PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with MFP-0012625-001-002 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BXN isoquinolin-4-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.97 Å R-free 0.281
7I1W PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with 3632-JP-070-010 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BXO (1r,4r)-4-amino-N-[4-(hydroxymethyl)-2-methylquinolin-8-yl]cyclohexane-1-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.67 Å R-free 0.314
7I1Y PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with 3632-JP-070-004 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BXP (1s,3s)-3-amino-N-[4-(hydroxymethyl)-2-methylquinolin-8-yl]cyclobutane-1-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.95 Å R-free 0.311
7I1Z PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with NegAcid1-Am02 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BXQ [(3R)-3-aminopyrrolidin-1-yl](2-{[4-(hydroxymethyl)-2-methylquinolin-8-yl]methyl}phenyl)methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.72 Å R-free 0.301
7I20 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with NegAcid3-Am02 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1BXR 1-[(3R)-3-aminopyrrolidin-1-yl]-2-[4-(hydroxymethyl)-2-methylquinolin-8-yl]ethan-1-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.92 Å R-free 0.284
7I21 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with NegAcid3-Am03 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 4 A1BXS 1-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-2-[4-(hydroxymethyl)-2-methylquinolin-8-yl]ethan-1-one × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.83 Å R-free 0.305
7I22 PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with Amine4-Ac06 Deposited 2025-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1BXV N-[4-(hydroxymethyl)-2-methylquinolin-8-yl]-3-(piperidin-4-yl)propanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.91 Å R-free 0.286
7I9J Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0016806-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	SO4 SULFATE ION × 1 DMS DIMETHYL SULFOXIDE × 2 A1B89 benzyl (3-{[3-(aminomethyl)phenyl]carbamoyl}-5-chlorophenyl)carbamate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.74 Å R-free 0.282
7I9K Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0017670-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1B88 benzyl (3-{[3-(2-aminoethyl)phenyl]carbamoyl}-5-chlorophenyl)carbamate × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.75 Å R-free 0.276
7I9L Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0017692-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1B87 benzyl (3-{[4-(2-aminoethyl)phenyl]carbamoyl}-5-chlorophenyl)carbamate × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.55 Å R-free 0.246
7I9M Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0017733-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B86 benzyl [3-({4-[(1R)-1-aminoethyl]phenyl}carbamoyl)-5-chlorophenyl]carbamate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.86 Å R-free 0.261
7I9N Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0022474-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B85 (4S)-N-[3-(aminomethyl)phenyl]-2-[(pyrrolidin-1-yl)methyl]imidazo[1,2-a]pyridine-8-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.72 Å R-free 0.269
7I9O Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0022538-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9O N-[3-(aminomethyl)phenyl]-2-(propan-2-yl)-1H-1,3-benzimidazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.96 Å R-free 0.289
7I9P Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0027707-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 3 A1B9N 3-(aminomethyl)-5-chloro-N-[3-(2H-tetrazol-5-yl)phenyl]benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.54 Å R-free 0.259
7I9Q Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0028904-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1B9L (2R)-(6-chloro-1H-indazol-4-yl)[(2,3-dihydro-1H-isoindol-5-yl)amino]acetonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.02 Å R-free 0.278
7I9R Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029000-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9M (2R)-2-(6-chloro-1H-indazol-4-yl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]-N-(propan-2-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.60 Å R-free 0.291
7I9S Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029002-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1B9C 6-bromo-N-(2,3-dihydro-1H-isoindol-5-yl)-1H-indole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.72 Å R-free 0.266
7I9T Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029045-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9D 3-bromo-N-(2,3-dihydro-1H-isoindol-5-yl)naphthalene-1-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.67 Å R-free 0.302
7I9U Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029491-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1B9E (2R)-2-(3-chloro-5-cyclopropylphenyl)-N-(2,2-difluoroethyl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.16 Å R-free 0.274
7I9V Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029424-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9G 6-chloro-N-(2,3,4,5-tetrahydro-1,4-benzoxazepin-7-yl)-1H-indazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.35 Å R-free 0.294
7I9W Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029497-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9F N-(2,3-dihydro-1H-isoindol-5-yl)-6-fluoro-1H-indazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.19 Å R-free 0.290
7I9X Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029394-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8Q N-(2,3-dihydro-1H-isoindol-5-yl)-6-fluoro-1H-1,2,3-benzotriazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.19 Å R-free 0.260
7I9Y Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029881-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8P ethyl 5-[({(2R)-2-(3-chloro-5-cyclopropylphenyl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]acetyl}amino)methyl]-1,3-oxazole-4-carboxylate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.68 Å R-free 0.269
7I9Z Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029804-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8O (2R)-2-(6-chloro-1H-indazol-4-yl)-N-methyl-2-[(3-oxo-1,3-dihydro-2-benzofuran-5-yl)amino]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.29 Å R-free 0.263
7IA0 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029796-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8N N-(2,3-dihydro-1H-isoindol-5-yl)-1,3-benzothiazole-6-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.39 Å R-free 0.312
7IA1 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029758-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8K N-(2,3-dihydro-1H-isoindol-5-yl)-1H-pyrazolo[3,4-c]pyridine-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.53 Å R-free 0.303
7IA2 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029832-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8J N-(2,3-dihydro-1H-isoindol-5-yl)-7-fluoro-1H-indole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.03 Å R-free 0.287
7IA3 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029909-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8I 3-chloro-4-cyano-N-(2,3-dihydro-1H-isoindol-5-yl)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.12 Å R-free 0.279
7IA4 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029864-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8H N-(2,3-dihydro-1H-isoindol-5-yl)-1H-1,3-benzimidazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.12 Å R-free 0.275
7IA5 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029816-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1B8M N-(2,3-dihydro-1H-isoindol-5-yl)-3,3-dimethyl-2-oxo-2,3-dihydro-1H-indole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.03 Å R-free 0.278
7IA6 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029835-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8L 6-acetamido-N-(2,3-dihydro-1H-isoindol-5-yl)pyridine-2-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.04 Å R-free 0.282
7IA7 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029916-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8W 6-bromo-N-(2,3-dihydro-1H-isoindol-5-yl)-2-oxo-2,3-dihydro-1H-1,3-benzimidazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.31 Å R-free 0.299
7IA8 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029899-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 2 A1B8V N-(2,3-dihydro-1H-isoindol-5-yl)-2-methyl-2H-indazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.13 Å R-free 0.297
7IA9 Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029890-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8U 3-amino-N-(2,3-dihydro-1H-isoindol-5-yl)-1,2-benzoxazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.25 Å R-free 0.273
7IAA Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029888-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8T (2R)-2-(6-chloro-1H-indazol-4-yl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]-N-(oxan-4-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.95 Å R-free 0.283
7IAB Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029928-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8S (2P)-5-chloro-N-(2,3-dihydro-1H-isoindol-5-yl)-2-(1H-1,2,4-triazol-1-yl)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.15 Å R-free 0.304
7IAC Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029858-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8R N-(2,3-dihydro-1H-isoindol-5-yl)-2-(trifluoromethyl)-1H-1,3-benzimidazole-7-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.15 Å R-free 0.265
7IAD Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029875-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9I 5-chloro-N-(2,3-dihydro-1H-isoindol-5-yl)-2-methyl-1H-1,3-benzimidazole-7-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.35 Å R-free 0.282
7IAE Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029783-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9J N-(2,3-dihydro-1H-isoindol-5-yl)-2-oxo-2,3-dihydro-1H-1,3-benzimidazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.44 Å R-free 0.301
7IAF Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029814-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9K (2R)-2-(6-chloro-1H-indazol-4-yl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]-N-(2-methylpropyl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.34 Å R-free 0.298
7IAG Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029905-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9B (2R)-2-(6-chloro-1H-indazol-4-yl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]-N-propylacetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.76 Å R-free 0.307
7IAH Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029845-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B84 (2S)-[(2,3-dihydro-1H-isoindol-5-yl)amino](isoquinolin-4-yl)acetonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.19 Å R-free 0.314
7IAI Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029753-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B83 N-(2,3-dihydro-1H-isoindol-5-yl)thieno[3,2-b]pyridine-2-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.88 Å R-free 0.259
7IAJ Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029751-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B82 6-chloro-N-(2,3-dihydro-1H-isoindol-5-yl)-1H-pyrrolo[2,3-b]pyridine-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.20 Å R-free 0.294
7IAK Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029797-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B81 N-(2,3-dihydro-1H-isoindol-5-yl)-1,2-benzothiazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.15 Å R-free 0.281
7IAL Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029640-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B80 (2R)-2-(6-chloro-1H-indazol-4-yl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]-N-[(4-methylbenzene-1-sulfonyl)methyl]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.15 Å R-free 0.295
7IAM Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029540-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8Z (2M)-5-chloro-N-(2,3-dihydro-1H-isoindol-5-yl)-2-(1H-imidazol-1-yl)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.94 Å R-free 0.269
7IAN Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029729-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8Y (7R)-N-(2,3-dihydro-1H-isoindol-5-yl)-2,2-difluoro-7-methyl-6-azaspiro[3.4]octane-6-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.86 Å R-free 0.265
7IAO Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029543-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B8X (2R)-2-(6-chloro-1H-indazol-4-yl)-2-[(2,3-dihydro-1H-isoindol-5-yl)amino]-N-[(oxan-4-yl)methyl]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.24 Å R-free 0.302
7IAP Group deposition of ZIKV NS2B-NS3 protease in complex with inhibitors from ASAP Discovery Consortium -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0029723-001 Deposited 2025-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Mutation：None	DMS DIMETHYL SULFOXIDE × 1 A1B9A 6-cyclopropyl-N-(2,3-dihydro-1H-isoindol-5-yl)-1-methyl-1H-pyrazolo[3,4-b]pyridine-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 2.35 Å R-free 0.282
7O55 Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2231 Deposited 2021-04-07	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 20 % PEG2000 macroseeding was performed to obtain larger crystal	Resolution 1.95 Å R-free 0.234
7OBV Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2248 Deposited 2021-04-23	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 3 % PEG2000	Resolution 1.30 Å R-free 0.154
7OC2 Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2295 Deposited 2021-04-25	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 19 % PEG2000	Resolution 1.50 Å R-free 0.155
7PFQ Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2247 Deposited 2021-08-11	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 15% PEG2000	Resolution 1.45 Å R-free 0.154
7PFY Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2241 Deposited 2021-08-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 20% PEG2000	Resolution 1.38 Å R-free 0.189
7PFZ Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2267 Deposited 2021-08-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 16% PEG2000	Resolution 1.45 Å R-free 0.172
7PG1 Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2221 Deposited 2021-08-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 17% PEG2000	Resolution 1.95 Å R-free 0.238
7PGC Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2191 Deposited 2021-08-13	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 9 % PEG2000	Resolution 1.55 Å R-free 0.171
7VLG Crystal structure of Zika NS2B-NS3 protease with compound MI2201 Deposited 2021-10-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	SO4 SULFATE ION × 1 7PZ 1-[(5~{R},8~{R},15~{S},18~{S})-15,18-bis(4-azanylbutyl)-4,7,14,17,20-pentakis(oxidanylidene)-5-propan-2-yl-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；2M Ammonium Sulfate	Resolution 1.77 Å R-free 0.197
7VLH Crystal structure of Zika NS2B-NS3 protease with compound MI2219 Deposited 2021-10-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	7Q3 1-[(3~{S},6~{R},18~{R})-3,6-bis(4-azanylbutyl)-2,5,8,11,14,17-hexakis(oxidanylidene)-1,4,7,10,13,16-hexazacyclodocos-18-yl]guanidine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；2M Ammonium Sulfate	Resolution 2.62 Å R-free 0.289
7VLI Crystal structure of Zika NS2B-NS3 protease with compound MI2220 Deposited 2021-10-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa）	Not recorded	7QG 1-[(3~{S},6~{S},19~{R})-3,6-bis(4-azanylbutyl)-2,5,8,12,15,18-hexakis(oxidanylidene)-1,4,7,11,14,17-hexazacyclotricos-19-yl]guanidine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；2M Ammonium Sulfate	Resolution 2.38 Å R-free 0.288
7ZLC Crystal Structure of Unlinked NS2B_NS3 Protease from Zika Virus in Complex with Inhibitor MI-2224 Deposited 2022-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	IXU (2~{S})-6-azanyl-~{N}-[(2~{S})-6-azanyl-1-(5-carbamimidamidopentylamino)-1-oxidanylidene-hexan-2-yl]-2-(propanoylamino)hexanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 17 % PEG2000	Resolution 1.75 Å R-free 0.223
7ZLD Crystal Structure of Unlinked NS2B_NS3 Protease from Zika Virus in Complex with Inhibitor MI-2223 Deposited 2022-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	IY3 (2~{S})-2-[2-[3-(aminomethyl)phenyl]ethanoylamino]-6-azanyl-~{N}-[(2~{S})-6-azanyl-1-[[(5~{R})-6-azanyl-5-carbamimidamido-6-oxidanylidene-hexyl]amino]-1-oxidanylidene-hexan-2-yl]hexanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 19 % PEG2000 macroseeding was performed to obtain larger crystal	Resolution 1.61 Å R-free 0.210
7ZMI Crystal Structure of Unlinked NS2B_NS3 Protease from Zika Virus in Complex with Inhibitor MI-2113 Deposited 2022-04-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	IXJ (2~{R})-6-[[(2~{S})-6-azanyl-2-[[(2~{S})-6-azanyl-2-(2-phenylethanoylamino)hexanoyl]amino]hexanoyl]amino]-2-carbamimidamido-hexanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 16 % PEG2000	Resolution 2.15 Å R-free 0.231
7ZNO Crystal Structure of Unlinked NS2B_NS3 Protease from Zika Virus in Complex with Boronate Inhibitor MI-2270 Deposited 2022-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	JQI [(1R)-1-[[(2S)-6-azanyl-2-[[(2S)-6-azanyl-2-[2-[3-(4-carbamimidamido-3-oxidanylidene-pentyl)phenyl]ethanoylamino]hexanoyl]amino]hexanoyl]amino]-3-methyl-butyl]boronic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 24 % PEG 2000	Resolution 1.70 Å R-free 0.225
7ZPD Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2293 Deposited 2022-04-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	JVC 1-[(8R,15S,18S)-15-[[3-(aminomethyl)phenyl]methyl]-18-(4-azanylbutyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 11 % PEG2000	Resolution 1.40 Å R-free 0.152
7ZQ1 Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2205 Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	JVL 1-[(8R,15S,18S)-15-(4-azanylbutyl)-18-(1H-indol-3-ylmethyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 20 % PEG2000 macroseeding was performed to obtain larger crystal	Resolution 1.52 Å R-free 0.163
7ZQF Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2206 Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	GOL GLYCEROL × 1 JW6 1-[(8R,15S,18S)-15-(4-azanylbutyl)-18-[(3-azanyl-4-oxidanyl-phenyl)methyl]-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 1.8 M ammonium sulfate	Resolution 1.68 Å R-free 0.166
7ZTM Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2128 Deposited 2022-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	JVU 1-[(5R,8R,15S,18S)-15-(4-azanylbutyl)-5-(cyclohexylmethyl)-18-(naphthalen-2-ylmethyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1 M sodium acetate 0.2 M ammonium sulfate 18 % PEG2000	Resolution 1.45 Å R-free 0.175
7ZUM Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2130 Deposited 2022-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	JN9 1-[(5R,8R,15S,18S)-15-(4-azanylbutyl)-5-(cyclohexylmethyl)-18-(1H-indol-3-ylmethyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0,1 M sodium acetate pH4.6 1,4 M ammonium sulfate	Resolution 1.75 Å R-free 0.204
7ZV4 Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2195 Deposited 2022-05-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	IBW 1-[(5R,8R,15S,18S)-15-[[3-(aminomethyl)phenyl]methyl]-18-(4-azanylbutyl)-5-(cyclohexylmethyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 18 % PEG2000	Resolution 1.69 Å R-free 0.196
7ZVV Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2196 Deposited 2022-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	V7T (2R)-6-azanyl-2-carbamimidamido-hexanoic acid × 1 ZAL 3-cyclohexyl-D-alanine × 1 V8N 2-[3-(aminomethyl)phenyl]ethanoic acid × 1 4CF 4-cyano-L-phenylalanine × 1 3CF 3-cyano-L-phenylalanine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 18% PEG2000	Resolution 1.75 Å R-free 0.222
7ZW5 Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2259 Deposited 2022-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	JG0 1-[(8R,15S,18S)-15-(4-azanylbutyl)-18-(2-carbamimidamidoethyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 14% PEG2000	Resolution 1.38 Å R-free 0.156
7ZWK Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2162 Deposited 2022-05-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 22% PEG2000	Resolution 2.00 Å R-free 0.222
7ZYS Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2227 Deposited 2022-05-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	KNR 1-[(8~{R},15~{S},18~{S})-18-(4-azanylbutyl)-15-butyl-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(26),22,24-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate 0.2 M ammonium sulfate 16% PEG2000	Resolution 1.26 Å R-free 0.152
8A15 Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2230 Deposited 2022-05-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	KPO 1-[(8~{R},15~{S},18~{S})-15-(4-azanylbutyl)-18-(naphthalen-2-ylmethyl)-4,7,14,17,20-pentakis(oxidanylidene)-3,6,13,16,19-pentazabicyclo[20.3.1]hexacosa-1(25),22(26),23-trien-8-yl]guanidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 21% PEG2000	Resolution 1.23 Å R-free 0.146
8AQA Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2260 Deposited 2022-08-11	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 16% PEG 2000	Resolution 1.35 Å R-free 0.165
8AQB Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2257 Deposited 2022-08-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 15% PEG2000	Resolution 1.28 Å R-free 0.154
8AQK Crystal Structure of Unlinked NS2B-NS3 Protease from Zika Virus in Complex with Inhibitor MI-2258 Deposited 2022-08-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1414–1464（51 aa） Chain B 1499–1675（177 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6 0.2 M ammonium sulfate 17% PEG2000	Resolution 1.20 Å R-free 0.147
8PEM Zika Methyltransferase in complex with AT-9010 and SAH Deposited 2023-06-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2517–2780（264 aa）	Not recorded	AT9 [[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-4-fluoranyl-4-methyl-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291.15 K；25% PEG3350, 0.1M Sodium HEPES 7.5, 0.2M Magnesium chloride hexahydrate	Resolution 2.00 Å R-free 0.259
8PN6 Crystal Structure of co-expressed NS2B-NS3 Protease from Zika Virus Deposited 2023-06-29	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.61 Å R-free 0.258
8UM3 PanDDA analysis -- Crystal Structure of Zika virus NS3 Helicase in complex with Z203039992 Deposited 2023-10-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 W41 6-chlorotetrazolo[1,5-b]pyridazine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.12 M NPS Mix (0.3 M Sodium phosphate dibasic dihydrate, 0.3 M Ammonium sulphate and 0.3 M Sodium nitrate - Molecular Dimensions), 0.1 M MES/Imidazole pH 6.5 (Molecular Dimensions) and 33% Precipitant Mix 4 (11% MPD, 11% PEG 1,000 e 11% PEG 3,350	Resolution 1.93 Å R-free 0.239
8V0H Structural characterization of zika virus NS2B by NMR and RosettaMP Deposited 2023-11-17	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1369–1498（130 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 0；Pressure 1 NMR sample composition 20 mM sodium phosphate, 0.1 % w/v sodium dodecyl sulfate, 2 mM beta-mercaptoethanol, 5 mM sodium azide, 100 % [U-2H] D2O \| 100 % [U-2H] D2O	Resolution not provided
8V7R PanDDA analysis -- Crystal Structure of Zika virus NS3 Helicase in complex with Z56772132 Deposited 2023-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 1 YG9 (5R)-5-[2-(4-methoxyphenyl)ethyl]-5-methylimidazolidine-2,4-dione × 2 DMS DIMETHYL SULFOXIDE × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；11.5% PEG 1000 11.5% PEG 3350 11.5% MPD 0.09 M NPS 0.1 M MES-imidazole pH 6.7	Resolution 1.41 Å R-free 0.206
8V7U PanDDA analysis -- Crystal Structure of Zika virus NS3 Helicase in complex with Z729726784 Deposited 2023-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 8 EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 YDU 2-cyclopentyl-N-(3-methyl-1,2,4-oxadiazol-5-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；298 K；11.5% PEG 1000 11.5% PEG 3350 11.5% MPD 0.09 M NPS 0.1 M MES-imidazole pH 6.7	Resolution 1.82 Å R-free 0.215
8WN8 CryoEM structure of ZIKV rsNS1 Deposited 2023-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 791–1143（353 aa） Chain C 791–1143（353 aa） Chain D 791–1143（353 aa） Chain E 791–1143（353 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8WNP ZIKV rsNS1 in complex with Fab AA12 and anti-fab nanobody Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 791–1142（352 aa） Chain F 791–1142（352 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8WNU ZIKV rsNS1 in complex with Fab GB5 and anti-fab nanobody Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 791–1142（352 aa） Chain F 791–1142（352 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8WO0 CryoEM structure of ZIKV rsNS1 filament Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 10 PDB declaration: decameric	Chain B 791–1142（352 aa） Chain C 791–1142（352 aa） Chain D 791–1142（352 aa） Chain E 791–1142（352 aa） Chain F 791–1142（352 aa） Chain G 791–1142（352 aa） Chain K 791–1142（352 aa） Chain L 791–1142（352 aa） Chain M 791–1142（352 aa） Chain N 791–1142（352 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
8WO4 ZIKV rsNS1 in complex with Fab EB9 and anti-fab nanobody Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 791–1143（353 aa） Chain F 791–1143（353 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9QS2 Crystal structure of Zika Virus NS2B-NS3 protease in complex with Z100582766 Deposited 2025-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1500–1675（176 aa）	Mutation：R107K, C143S	A1I9X 1-methyl-~{N}-(pyridin-2-ylmethyl)pyrazole-4-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；26 % (w/v) PEG 2000, 0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate	Resolution 1.65 Å R-free 0.225
9QSP Crystal structure of Zika Virus NS2B-NS3 protease in complex with Z2242050769 Deposited 2025-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1500–1675（176 aa）	Mutation：C143S, R107K	A1JAB ~{N}-(2,2-dimethylpropyl)pyridin-2-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；24 % (w/v) PEG 2000, 0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate	Resolution 1.40 Å R-free 0.216
9RGA Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS87208 from ECBL Deposited 2025-06-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1500–1675（176 aa）	Mutation：C143S, R107K	A1JFZ (3,5-dimethylfuran-2-yl)-[(2~{S})-2-(methylaminomethyl)pyrrolidin-1-yl]methanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate, 24 % (w/v) PEG 2000	Resolution 1.38 Å R-free 0.190
9RGA Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS87208 from ECBL Deposited 2025-06-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1414–1464（51 aa） Chain D 1500–1675（176 aa）	Mutation：C143S, R107K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate, 24 % (w/v) PEG 2000	Resolution 1.38 Å R-free 0.190
9RGF Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS41783 from ECBL Deposited 2025-06-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1500–1675（176 aa）	Mutation：C143S, R107K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate, 24 % (w/v) PEG 2000	Resolution 1.60 Å R-free 0.216
9RGF Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS41783 from ECBL Deposited 2025-06-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1414–1464（51 aa） Chain D 1500–1675（176 aa）	Mutation：C143S, R107K	A1JF3 ~{N}-[(2~{S})-2-(6,7-dihydro-4~{H}-thieno[3,2-c]pyridin-5-yl)propyl]-5-methyl-furan-2-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate, 24 % (w/v) PEG 2000	Resolution 1.60 Å R-free 0.216
9RGG Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS90861 from ECBL Deposited 2025-06-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1464（51 aa） Chain B 1500–1675（176 aa）	Mutation：C143S, R107K	A1JF2 3-[[[(2~{R})-2-[2,4-bis(fluoranyl)phenyl]-2-oxidanyl-ethyl]amino]methyl]quinolin-2-ol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate, 24 % (w/v) PEG 2000	Resolution 1.58 Å R-free 0.208
9RGG Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS90861 from ECBL Deposited 2025-06-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1414–1464（51 aa） Chain D 1500–1675（176 aa）	Mutation：C143S, R107K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate pH 4.6, 0.2 M ammonium sulfate, 24 % (w/v) PEG 2000	Resolution 1.58 Å R-free 0.208
9RM4 Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0015373 Deposited 2025-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain AAA 1414–1457（44 aa） Chain AAA 1509–1675（167 aa） Chain BBB 1414–1457（44 aa） Chain BBB 1509–1675（167 aa）	Not recorded	A1JHM ~{N}-[3-chloranyl-5-[(2-methyl-1-oxidanyl-propan-2-yl)carbamoyl]phenyl]-5-[(dimethylamino)methyl]-1~{H}-pyrrole-2-carboxamide × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.95 Å R-free 0.278
9RM6 Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0027808 Deposited 2025-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain A 1509–1675（167 aa） Chain B 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Not recorded	A1JHN 6-chloranyl-~{N}-(2,3-dihydro-1~{H}-isoindol-5-yl)-1~{H}-indazole-4-carboxamide × 1 DMS DIMETHYL SULFOXIDE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.50 Å R-free 0.228
9RM7 Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0036543 Deposited 2025-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1457（44 aa） Chain A 1509–1675（167 aa） Chain B 1414–1457（44 aa） Chain B 1509–1675（167 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 1 A1JHL (2~{S})-~{N}-[2,2-bis(fluoranyl)ethyl]-2-(2,3-dihydro-1~{H}-isoindol-5-ylamino)-2-[3-methyl-5-(trifluoromethyl)phenyl]ethanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30% w/v PEG 2000, 0.2M Ammonium sulfate, 0.1M acetate (pH 4.8)	Resolution 1.45 Å R-free 0.222
9WA5 Crystal structure of an inactive form of NS2B-NS3 Protease Deposited 2025-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1414–1435（22 aa） Chain A 1499–1675（177 aa） Chain B 1414–1435（22 aa） Chain B 1499–1675（177 aa）	Not recorded	MG MAGNESIUM ION × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.03M Magnesium chloride hexahydrate, 0.03M Calcium chloride dihydrate, 0.1M Buffer Tris (base)/BICINE 8.5, 20% v/v Ethylene glycol, 10% w/v PEG 8000	Resolution 2.40 Å R-free 0.242
9Y51 PanDDA analysis -- Crystal Structure of Zika virus NS3 Helicase in complex with Z1563512128 Deposited 2025-09-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1681–2115（435 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PO4 PHOSPHATE ION × 2 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 M0J N-[(2S)-2-hydroxypropyl]-N'-phenylurea × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；11.5% PEG1000, 11.5% PEG3350, 11.5% MPD, 0.09 M NPS, 0.1 M MES-imidazole, pH 6.7	Resolution 1.73 Å R-free 0.213

263 other PDB entries and 301 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_ZIKV
Isoform	—
PDB entities	2, 3
Chains and sequence ranges	Author chain B； PDBConstruct 1–153； UniProt 1516–1668 Author chain D； PDBConstruct 1–161； UniProt 1511–1671

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8y9v
Deposition date deposition_date	2024-02-07
最后修订 last_revision	2024-02-28
Structure title title	ZIKV NS2B/NS3 protease
Keywords keywords	ZIKV, NS2B/NS3 protease, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.78 Å
Radius of gyration Rg (electron density) rg_electron	23.08 Å
Forward intensity I(0) i0	29516400.00
Molecular weight molecular_weight	41224.0 kDa
Excluded volume excluded_volume	51452 Å³
Envelope volume envelope_volume	62657 Å³
Hydration-shell volume shell_volume	23096 Å³
Envelope diameter envelope_diameter	81.3 Å
Shell Rg shell_rg	29.58 Å
Envelope Rg envelope_rg	23.26 Å
Shape Rg shape_rg	23.04 Å
Total Rg total_rg	23.99 Å
Total atoms total_atoms	2904
Residues n_residues	385
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	79.4 Å
Rg (real space) rg_real	23.80 Å
Rg uncertainty (real space) rg_real_error	0.55 Å
I(0) (real space) i0_real	2.9520e+07
I(0) uncertainty (real space) i0_real_error	4.4280e+05
Rg (reciprocal space) rg_reciprocal	23.80 Å
I(0) (reciprocal space) i0_reciprocal	29520000.0000
Solution quality estimate total_estimate	0.7164
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	24.8 Å
Skewness Skewness skewness	0.371
Kurtosis Kurtosis kurtosis	-0.440
Angular range angular_range	— – 0.3350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	12190000.0000
Real-space data points n_real_points	65
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.840; Stabil: 1.000; Sysdev: 0.286; Positv: 1.000; Valcen: 0.943; Smooth: 0.989

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Serine protease subunit NS2B
Molecular weight formula_weight	5865.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	3067

MTGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRE

来源 Source

来源生物 organism	Zika virus
NCBI Class编号 ncbi_taxonomy_id	64320
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Serine protease NS3
Molecular weight formula_weight	16354.6 kDa
EC 编号 ec_number	3.4.21.91,3.6.1.15,3.6.4.13
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKSGRVIGLYGNGVVIKNGSYVSAITQGKR

来源 Source

来源生物 organism	Zika virus
NCBI Class编号 ncbi_taxonomy_id	64320
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Serine protease NS3
Molecular weight formula_weight	17285.6 kDa
EC 编号 ec_number	3.4.21.91,3.6.1.15,3.6.4.13
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

VKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKSGRVIGLYGNGVVIKNGSYVSAITQGKREEE

来源 Source

来源生物 organism	Zika virus
NCBI Class编号 ncbi_taxonomy_id	64320
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	DAR-LYS-ORN-ARG
Molecular weight formula_weight	575.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

RKAR

来源 Source

来源生物 organism	synthetic construct
NCBI Class编号 ncbi_taxonomy_id	32630
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	163

▶

8. Citations (1)

▶

Unit-cell length a length_a	59.753 Å
Unit-cell length b length_b	59.753 Å
Unit-cell length c length_c	213.594 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	45.770 Å
R factor r_factor	0.2190
R_work r_work	0.2170
R_free r_free	0.2477

fit	/app/data/saxs_computation/y9/8y9v/8y9v.fit
pddf	/app/data/pr_computation/y9/8y9v/8y9v.pr.out
profile	/app/data/saxs_computation/y9/8y9v/8y9v.dat

ZIKV NS2B/NS3 protease

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine protease subunit NS2B

State in the Current Structure

Other States of the Same Protein in the Database

Serine protease NS3

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)