8yaa

Cryo-EM structure of MIK2-SCOOP12-BAK1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 3 其他Polymer 12	MDIS1-interacting receptor like kinase 2 × 1 （Q8VZG8） Serine rich endogenous peptide 12 × 1 （B3H7I1） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 10 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BAK1_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–177； UniProt 26–202

MDIS1-interacting receptor like kinase 2

Arabidopsis thaliana

UniProt Q8VZG8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 3 其他Polymer 12	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 × 1 （Q94F62） Serine rich endogenous peptide 12 × 1 （B3H7I1） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 10 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MIK2_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–654； UniProt 43–696

Serine rich endogenous peptide 12

OrganismNot specified

UniProt B3H7I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 3 其他Polymer 12	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 × 1 （Q94F62） MDIS1-interacting receptor like kinase 2 × 1 （Q8VZG8） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 10 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SOP12_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–13； UniProt 52–64

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8yaa
Deposition date deposition_date	2024-02-08
Structure title title	Cryo-EM structure of MIK2-SCOOP12-BAK1
Keywords keywords	LRR-RLK, SERK, MIK2, SCOOP, BAK1, PLANT PROTEIN, TRANSFERASE, PLANT PROTEIN complex, TRANSFERASE-PLANT PROTEIN complex; TRANSFERASE/PLANT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8yaa__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8yaa__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8yaa__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	35.18 Å
Rg (electron density)	34.68 Å
Total Rg	35.14 Å
Atom count	6985
Residues	844
Excluded volume	124460 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8yaa__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1
Molecular weight formula_weight	19160.7 kDa
EC 编号 ec_number	2.7.10.1,2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	6985

NAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFHVTCNSDNSVTRVDLGNANLSGQLVMQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIPVNGSFSLFTPISFANTKLTPL

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	MDIS1-interacting receptor like kinase 2
Molecular weight formula_weight	71858.7 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

AVSATVEEANALLKWKSTFTNQTSSSKLSSWVNPNTSSFCTSWYGVACSLGSIIRLNLTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNLQGPIPDNAAFRNAPPDAFEGNKDLCGSVNTTQGLKPCS

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Serine rich endogenous peptide 12
Molecular weight formula_weight	1318.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

PVRSSQSSQAGGR

Entity 4 Entity 4 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 6 Entity 6 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	8

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.340 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.34 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	319127

Cryo-EM structure of MIK2-SCOOP12-BAK1

1. Protein Identity and Related Structures Protein Identity & Related Structures

BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

State in the Current Structure

Other States of the Same Protein in the Database

MDIS1-interacting receptor like kinase 2

State in the Current Structure

Other States of the Same Protein in the Database

Serine rich endogenous peptide 12

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8yaa__assembly_1__model_1

8yaa__assembly_1__model_1 | I(q)

8yaa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

7. Citations (1)

Cryo-EM structure of MIK2-SCOOP12-BAK1

1. Protein Identity and Related Structures Protein Identity & Related Structures

BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MDIS1-interacting receptor like kinase 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Serine rich endogenous peptide 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8yaa__assembly_1__model_1

8yaa__assembly_1__model_1 | I(q)

8yaa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

7. Citations (1)