8z5n

Cryo-EM structure of the LPHT ring

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Component of sodium-driven polar flagellar motor

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 182	Sodium-type flagellar motor component × 26 （Q93R25） Flagellar L-ring protein × 26 （A0A9W4BB53） Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） The N-terminus of Flagellar L-ring protein × 26 Flagellar P-ring protein × 26 （A0A9W4BSQ4） Flagella basal-body protein × 26 （D9N551）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P74944_VIBAL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–293； UniProt 1–293 Author chain B； PDBConstruct 1–293； UniProt 1–293 Author chain E； PDBConstruct 1–293； UniProt 1–293 Author chain F； PDBConstruct 1–293； UniProt 1–293 Author chain I； PDBConstruct 1–293； UniProt 1–293 Author chain J； PDBConstruct 1–293； UniProt 1–293 Author chain M； PDBConstruct 1–293； UniProt 1–293 Author chain N； PDBConstruct 1–293； UniProt 1–293 Author chain Q； PDBConstruct 1–293； UniProt 1–293 Author chain R； PDBConstruct 1–293； UniProt 1–293 Author chain U； PDBConstruct 1–293； UniProt 1–293 Author chain V； PDBConstruct 1–293； UniProt 1–293 Author chain Y； PDBConstruct 1–293； UniProt 1–293 Author chain Z； PDBConstruct 1–293； UniProt 1–293 Author chain c； PDBConstruct 1–293； UniProt 1–293 Author chain d； PDBConstruct 1–293； UniProt 1–293 Author chain g； PDBConstruct 1–293； UniProt 1–293 Author chain h； PDBConstruct 1–293； UniProt 1–293 Author chain k； PDBConstruct 1–293； UniProt 1–293 Author chain l； PDBConstruct 1–293； UniProt 1–293 Author chain o； PDBConstruct 1–293； UniProt 1–293 Author chain p； PDBConstruct 1–293； UniProt 1–293 Author chain s； PDBConstruct 1–293； UniProt 1–293 Author chain t； PDBConstruct 1–293； UniProt 1–293 Author chain w； PDBConstruct 1–293； UniProt 1–293 Author chain x； PDBConstruct 1–293； UniProt 1–293

Sodium-type flagellar motor component

OrganismNot specified

UniProt Q93R25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 182	Component of sodium-driven polar flagellar motor × 26 （P74944） Flagellar L-ring protein × 26 （A0A9W4BB53） Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） The N-terminus of Flagellar L-ring protein × 26 Flagellar P-ring protein × 26 （A0A9W4BSQ4） Flagella basal-body protein × 26 （D9N551）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93R25_VIBAL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–211； UniProt 1–211 Author chain D； PDBConstruct 1–211； UniProt 1–211 Author chain G； PDBConstruct 1–211； UniProt 1–211 Author chain H； PDBConstruct 1–211； UniProt 1–211 Author chain K； PDBConstruct 1–211； UniProt 1–211 Author chain L； PDBConstruct 1–211； UniProt 1–211 Author chain O； PDBConstruct 1–211； UniProt 1–211 Author chain P； PDBConstruct 1–211； UniProt 1–211 Author chain S； PDBConstruct 1–211； UniProt 1–211 Author chain T； PDBConstruct 1–211； UniProt 1–211 Author chain W； PDBConstruct 1–211； UniProt 1–211 Author chain X； PDBConstruct 1–211； UniProt 1–211 Author chain a； PDBConstruct 1–211； UniProt 1–211 Author chain b； PDBConstruct 1–211； UniProt 1–211 Author chain e； PDBConstruct 1–211； UniProt 1–211 Author chain f； PDBConstruct 1–211； UniProt 1–211 Author chain i； PDBConstruct 1–211； UniProt 1–211 Author chain j； PDBConstruct 1–211； UniProt 1–211 Author chain m； PDBConstruct 1–211； UniProt 1–211 Author chain n； PDBConstruct 1–211； UniProt 1–211 Author chain q； PDBConstruct 1–211； UniProt 1–211 Author chain r； PDBConstruct 1–211； UniProt 1–211 Author chain u； PDBConstruct 1–211； UniProt 1–211 Author chain v； PDBConstruct 1–211； UniProt 1–211 Author chain y； PDBConstruct 1–211； UniProt 1–211 Author chain z； PDBConstruct 1–211； UniProt 1–211

Flagellar L-ring protein

OrganismNot specified

UniProt A0A9W4BB53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 182	Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） The N-terminus of Flagellar L-ring protein × 26 Flagellar P-ring protein × 26 （A0A9W4BSQ4） Flagella basal-body protein × 26 （D9N551）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9W4BB53_VIBAL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 1； PDBConstruct 1–259； UniProt 1–259 Author chain 6； PDBConstruct 1–259； UniProt 1–259 Author chain A4； PDBConstruct 1–259； UniProt 1–259 Author chain A9； PDBConstruct 1–259； UniProt 1–259 Author chain AA； PDBConstruct 1–259； UniProt 1–259 Author chain AF； PDBConstruct 1–259； UniProt 1–259 Author chain AK； PDBConstruct 1–259； UniProt 1–259 Author chain AP； PDBConstruct 1–259； UniProt 1–259 Author chain AU； PDBConstruct 1–259； UniProt 1–259 Author chain AZ； PDBConstruct 1–259； UniProt 1–259 Author chain Ae； PDBConstruct 1–259； UniProt 1–259 Author chain Aj； PDBConstruct 1–259； UniProt 1–259 Author chain Ao； PDBConstruct 1–259； UniProt 1–259 Author chain At； PDBConstruct 1–259； UniProt 1–259 Author chain Ay； PDBConstruct 1–259； UniProt 1–259 Author chain B2； PDBConstruct 1–259； UniProt 1–259 Author chain BD； PDBConstruct 1–259； UniProt 1–259 Author chain BI； PDBConstruct 1–259； UniProt 1–259 Author chain BN； PDBConstruct 1–259； UniProt 1–259 Author chain BS； PDBConstruct 1–259； UniProt 1–259 Author chain BX； PDBConstruct 1–259； UniProt 1–259 Author chain Bc； PDBConstruct 1–259； UniProt 1–259 Author chain Bh； PDBConstruct 1–259； UniProt 1–259 Author chain Bm； PDBConstruct 1–259； UniProt 1–259 Author chain Br； PDBConstruct 1–259； UniProt 1–259 Author chain Bw； PDBConstruct 1–259； UniProt 1–259

Flagellar assembly lipoprotein FlgP

OrganismNot specified

UniProt A0A0H0Y943

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 182	Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） Flagellar L-ring protein × 26 （A0A9W4BB53） The N-terminus of Flagellar L-ring protein × 26 Flagellar P-ring protein × 26 （A0A9W4BSQ4） Flagella basal-body protein × 26 （D9N551）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0Y943_VIBAL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 2； PDBConstruct 1–143； UniProt 1–143 Author chain 7； PDBConstruct 1–143； UniProt 1–143 Author chain A0； PDBConstruct 1–143； UniProt 1–143 Author chain A5； PDBConstruct 1–143； UniProt 1–143 Author chain AB； PDBConstruct 1–143； UniProt 1–143 Author chain AG； PDBConstruct 1–143； UniProt 1–143 Author chain AL； PDBConstruct 1–143； UniProt 1–143 Author chain AQ； PDBConstruct 1–143； UniProt 1–143 Author chain AV； PDBConstruct 1–143； UniProt 1–143 Author chain Aa； PDBConstruct 1–143； UniProt 1–143 Author chain Af； PDBConstruct 1–143； UniProt 1–143 Author chain Ak； PDBConstruct 1–143； UniProt 1–143 Author chain Ap； PDBConstruct 1–143； UniProt 1–143 Author chain Au； PDBConstruct 1–143； UniProt 1–143 Author chain Az； PDBConstruct 1–143； UniProt 1–143 Author chain B3； PDBConstruct 1–143； UniProt 1–143 Author chain BE； PDBConstruct 1–143； UniProt 1–143 Author chain BJ； PDBConstruct 1–143； UniProt 1–143 Author chain BO； PDBConstruct 1–143； UniProt 1–143 Author chain BT； PDBConstruct 1–143； UniProt 1–143 Author chain BY； PDBConstruct 1–143； UniProt 1–143 Author chain Bd； PDBConstruct 1–143； UniProt 1–143 Author chain Bi； PDBConstruct 1–143； UniProt 1–143 Author chain Bn； PDBConstruct 1–143； UniProt 1–143 Author chain Bs； PDBConstruct 1–143； UniProt 1–143 Author chain Bx； PDBConstruct 1–143； UniProt 1–143

Flagellar P-ring protein

OrganismNot specified

UniProt A0A9W4BSQ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 182	Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） Flagellar L-ring protein × 26 （A0A9W4BB53） Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） The N-terminus of Flagellar L-ring protein × 26 Flagella basal-body protein × 26 （D9N551）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9W4BSQ4_VIBAL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 4； PDBConstruct 1–363； UniProt 1–363 Author chain 9； PDBConstruct 1–363； UniProt 1–363 Author chain A2； PDBConstruct 1–363； UniProt 1–363 Author chain A7； PDBConstruct 1–363； UniProt 1–363 Author chain AD； PDBConstruct 1–363； UniProt 1–363 Author chain AI； PDBConstruct 1–363； UniProt 1–363 Author chain AN； PDBConstruct 1–363； UniProt 1–363 Author chain AS； PDBConstruct 1–363； UniProt 1–363 Author chain AX； PDBConstruct 1–363； UniProt 1–363 Author chain Ac； PDBConstruct 1–363； UniProt 1–363 Author chain Ah； PDBConstruct 1–363； UniProt 1–363 Author chain Am； PDBConstruct 1–363； UniProt 1–363 Author chain Ar； PDBConstruct 1–363； UniProt 1–363 Author chain Aw； PDBConstruct 1–363； UniProt 1–363 Author chain B5； PDBConstruct 1–363； UniProt 1–363 Author chain BB； PDBConstruct 1–363； UniProt 1–363 Author chain BG； PDBConstruct 1–363； UniProt 1–363 Author chain BL； PDBConstruct 1–363； UniProt 1–363 Author chain BQ； PDBConstruct 1–363； UniProt 1–363 Author chain BV； PDBConstruct 1–363； UniProt 1–363 Author chain Ba； PDBConstruct 1–363； UniProt 1–363 Author chain Bf； PDBConstruct 1–363； UniProt 1–363 Author chain Bk； PDBConstruct 1–363； UniProt 1–363 Author chain Bp； PDBConstruct 1–363； UniProt 1–363 Author chain Bu； PDBConstruct 1–363； UniProt 1–363 Author chain Bz； PDBConstruct 1–363； UniProt 1–363

Flagella basal-body protein

OrganismNot specified

UniProt D9N551

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 182	Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） Flagellar L-ring protein × 26 （A0A9W4BB53） Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） The N-terminus of Flagellar L-ring protein × 26 Flagellar P-ring protein × 26 （A0A9W4BSQ4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D9N551_VIBAL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 0； PDBConstruct 1–377； UniProt 1–377 Author chain 5； PDBConstruct 1–377； UniProt 1–377 Author chain A3； PDBConstruct 1–377； UniProt 1–377 Author chain A8； PDBConstruct 1–377； UniProt 1–377 Author chain AE； PDBConstruct 1–377； UniProt 1–377 Author chain AJ； PDBConstruct 1–377； UniProt 1–377 Author chain AO； PDBConstruct 1–377； UniProt 1–377 Author chain AT； PDBConstruct 1–377； UniProt 1–377 Author chain AY； PDBConstruct 1–377； UniProt 1–377 Author chain Ad； PDBConstruct 1–377； UniProt 1–377 Author chain Ai； PDBConstruct 1–377； UniProt 1–377 Author chain An； PDBConstruct 1–377； UniProt 1–377 Author chain As； PDBConstruct 1–377； UniProt 1–377 Author chain Ax； PDBConstruct 1–377； UniProt 1–377 Author chain B1； PDBConstruct 1–377； UniProt 1–377 Author chain B6； PDBConstruct 1–377； UniProt 1–377 Author chain BC； PDBConstruct 1–377； UniProt 1–377 Author chain BH； PDBConstruct 1–377； UniProt 1–377 Author chain BM； PDBConstruct 1–377； UniProt 1–377 Author chain BR； PDBConstruct 1–377； UniProt 1–377 Author chain BW； PDBConstruct 1–377； UniProt 1–377 Author chain Bb； PDBConstruct 1–377； UniProt 1–377 Author chain Bg； PDBConstruct 1–377； UniProt 1–377 Author chain Bl； PDBConstruct 1–377； UniProt 1–377 Author chain Bq； PDBConstruct 1–377； UniProt 1–377 Author chain Bv； PDBConstruct 1–377； UniProt 1–377

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8z5n
Deposition date deposition_date	2024-04-18
Structure title title	Cryo-EM structure of the LPHT ring
Keywords keywords	Polar flagellum, Polar flagellar motor, LPHT ring, Bushing, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8z5n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8z5n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8z5n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	132.10 Å
Total Rg	132.00 Å
Atom count	269711
Residues	34671
Excluded volume	4773000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8z5n__assembly_1__model_1`	182-meric （182）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Component of sodium-driven polar flagellar motor
Molecular weight formula_weight	33528.0 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,F,I,J,M,N,Q,R,U,V,Y,Z,c,d,g,h,k,l,o,p,s,t,w,x
Atom count atom_count	269711

MKKWLITSGVVFSLFSTSSFAVMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDGKSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGKRRPIADNGSPIGKDKNRRVVISLGRTQV

Entity 2 Entity 2 polymer

Description description	Sodium-type flagellar motor component
Molecular weight formula_weight	24088.6 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,G,H,K,L,O,P,S,T,W,X,a,b,e,f,i,j,m,n,q,r,u,v,y,z

MKLRTVAASLLLTLVATTAKANVADVGAPVPIYTEAELIKLIEQNKHLQRVRADNCQLVEDIVARATRINLPAYEFLYGDMLAWGVCVEQDVELGLYYIENAAHQGLPAALEQIGRYYSRGTLVQQDKERAIPYLREAASMGNLNARIHLAELLLRDYGSPLDYEDAYRWLYNSVTADKRQHKRITVLRNGLEQRMPQNVIARAKRRDTFW

Entity 3 Entity 3 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	27930.0 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,6,AA,AF,AK,AP,AU,AZ,Ae,Aj,Ao,At,Ay,A4,A9,BD,BI,BN,BS,BX,Bc,Bh,Bm,Br,Bw,B2

MKRICLLALIATMSGCAMLEPIETDEVTQATTVVDAVEGDKSKEESSGIVDTLRGRSDPVAGDPAWAPIHPKKKPEHYAAATGSLFSAEHITDLYDDSKPRGIGDIITVTLDETTSATKSANADLSKTNEAQMDPLQVGGEELQIGGKYNFSYDLNNSNSFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSGTGVQQDMQEPGFLARFFNVAL

Entity 4 Entity 4 polymer

Description description	Flagellar assembly lipoprotein FlgP
Molecular weight formula_weight	16303.8 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,7,AB,AG,AL,AQ,AV,Aa,Af,Ak,Ap,Au,Az,A5,A0,BE,BJ,BO,BT,BY,Bd,Bi,Bn,Bs,Bx,B3

MKKLLFIVATLILVGCQPLQQMRQDEILVAVGYASVSEQTGRTVEEKRVRAMRASKIDAYRELAEQVYGMRVSGRAELQDQRLGIESTTGAVDGVIRGAEVVRSYLVEDSYVTELRLDIRKMDKLRDYGEVQQVPEKRQQTLF

Entity 5 Entity 5 polymer

Description description	The N-terminus of Flagellar L-ring protein
Molecular weight formula_weight	1450.6 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,8,AC,AH,AM,AR,AW,Ab,Ag,Al,Aq,Av,A1,A6,BA,BF,BK,BP,BU,BZ,Be,Bj,Bo,Bt,By,B4

CAMLEPIETDEVT

Entity 6 Entity 6 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	37892.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,9,AD,AI,AN,AS,AX,Ac,Ah,Am,Ar,Aw,A2,A7,BB,BG,BL,BQ,BV,Ba,Bf,Bk,Bp,Bu,Bz,B5

MKKLLLILMSVALFSTAAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEANPFTEQSFAAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGGTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNPFGRGDYITFNLLESDFTTAQRMADAVNNFLGPQMASAVDATSVRVRAPRDVSQRVAFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNGFSGGQTVVVPDSDIEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALKQAGAIEGQLIII

Entity 7 Entity 7 polymer

Description description	Flagella basal-body protein
Molecular weight formula_weight	42417.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,0,AE,AJ,AO,AT,AY,Ad,Ai,An,As,Ax,A3,A8,BC,BH,BM,BR,BW,Bb,Bg,Bl,Bq,Bv,B1,B6

MKKILNSLFSITLVMLVPFKVMASWYEVTGVATIVSSEETARLHALEDALFKAVNFSGADIGSISNLMPLLEESRNEYQFTNHEVRYILVESERKRRGKVEVKIRVDIYPSATGCHTDQYKKTILVGNIEVASPQQAVMGQIYQVGDDFSRVVNRQLDQTSRSFVSVGTTDYSISSNYPARTQMIAQDNGAQYIIGGVITDLTATVESQLLQDDIINRQFALEMKVFDGKTGHEVFNKAYREVARWPFAKTSQVDTRSARFWASTYGEMMLRVSRNIMLDLESELSCKITLPEVVAVFGNTVTMDLGRMHGVKEGDKLQLWHTASFIDQNGLPRNKVSQSEITLTVSRIYEHEAELTIDQPNLASSVQIGDVMNKIL

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.95 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	45233

Cryo-EM structure of the LPHT ring

1. Protein Identity and Related Structures Protein Identity & Related Structures

Component of sodium-driven polar flagellar motor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sodium-type flagellar motor component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar assembly lipoprotein FlgP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagella basal-body protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8z5n__assembly_1__model_1

8z5n__assembly_1__model_1 | I(q)

8z5n__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

7. Citations (1)