8z60

Cryo-EM structure of the polar flagellar motor-hook complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1W6TTE6_VIBAL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–289； UniProt 1–289 Author chain 2； PDBConstruct 1–289； UniProt 1–289 Author chain 3； PDBConstruct 1–289； UniProt 1–289 Author chain y； PDBConstruct 1–289； UniProt 1–289 Author chain z； PDBConstruct 1–289； UniProt 1–289

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt A0A0H0YAF4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YAF4_VIBAL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4； PDBConstruct 1–89； UniProt 1–89 Author chain 5； PDBConstruct 1–89； UniProt 1–89 Author chain 6； PDBConstruct 1–89； UniProt 1–89 Author chain 7； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt A0A0H0YFV7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YFV7_VIBAL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 8； PDBConstruct 1–260； UniProt 1–260

Flagellar basal-body rod protein FlgG

OrganismNot specified

UniProt A0A0H0YB44

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YB44_VIBAL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–262； UniProt 1–262 Author chain AP； PDBConstruct 1–262； UniProt 1–262 Author chain AQ； PDBConstruct 1–262； UniProt 1–262 Author chain AR； PDBConstruct 1–262； UniProt 1–262 Author chain AS； PDBConstruct 1–262； UniProt 1–262 Author chain AT； PDBConstruct 1–262； UniProt 1–262 Author chain AU； PDBConstruct 1–262； UniProt 1–262 Author chain AV； PDBConstruct 1–262； UniProt 1–262 Author chain AW； PDBConstruct 1–262； UniProt 1–262 Author chain AX； PDBConstruct 1–262； UniProt 1–262 Author chain AY； PDBConstruct 1–262； UniProt 1–262 Author chain AZ； PDBConstruct 1–262； UniProt 1–262 Author chain Aa； PDBConstruct 1–262； UniProt 1–262 Author chain B； PDBConstruct 1–262； UniProt 1–262 Author chain C； PDBConstruct 1–262； UniProt 1–262 Author chain P； PDBConstruct 1–262； UniProt 1–262 Author chain Q； PDBConstruct 1–262； UniProt 1–262 Author chain R； PDBConstruct 1–262； UniProt 1–262 Author chain S； PDBConstruct 1–262； UniProt 1–262 Author chain T； PDBConstruct 1–262； UniProt 1–262 Author chain U； PDBConstruct 1–262； UniProt 1–262 Author chain V； PDBConstruct 1–262； UniProt 1–262 Author chain W； PDBConstruct 1–262； UniProt 1–262 Author chain X； PDBConstruct 1–262； UniProt 1–262 Author chain Y； PDBConstruct 1–262； UniProt 1–262 Author chain Z； PDBConstruct 1–262； UniProt 1–262 Author chain a； PDBConstruct 1–262； UniProt 1–262

Flagellar hook protein FlgE

OrganismNot specified

UniProt A0A0H0YA78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YA78_VIBAL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A1； PDBConstruct 1–437； UniProt 1–437 Author chain A2； PDBConstruct 1–437； UniProt 1–437 Author chain A3； PDBConstruct 1–437； UniProt 1–437 Author chain Ab； PDBConstruct 1–437； UniProt 1–437 Author chain Ac； PDBConstruct 1–437； UniProt 1–437 Author chain Ad； PDBConstruct 1–437； UniProt 1–437 Author chain Ae； PDBConstruct 1–437； UniProt 1–437 Author chain Af； PDBConstruct 1–437； UniProt 1–437 Author chain Ag； PDBConstruct 1–437； UniProt 1–437 Author chain Ah； PDBConstruct 1–437； UniProt 1–437 Author chain Ai； PDBConstruct 1–437； UniProt 1–437 Author chain Aj； PDBConstruct 1–437； UniProt 1–437 Author chain Ak； PDBConstruct 1–437； UniProt 1–437 Author chain Al； PDBConstruct 1–437； UniProt 1–437 Author chain Am； PDBConstruct 1–437； UniProt 1–437 Author chain An； PDBConstruct 1–437； UniProt 1–437 Author chain Ao； PDBConstruct 1–437； UniProt 1–437 Author chain Ap； PDBConstruct 1–437； UniProt 1–437 Author chain Aq； PDBConstruct 1–437； UniProt 1–437 Author chain Ar； PDBConstruct 1–437； UniProt 1–437 Author chain As； PDBConstruct 1–437； UniProt 1–437 Author chain At； PDBConstruct 1–437； UniProt 1–437 Author chain Au； PDBConstruct 1–437； UniProt 1–437 Author chain Av； PDBConstruct 1–437； UniProt 1–437 Author chain Aw； PDBConstruct 1–437； UniProt 1–437 Author chain Ax； PDBConstruct 1–437； UniProt 1–437 Author chain Ay； PDBConstruct 1–437； UniProt 1–437 Author chain Az； PDBConstruct 1–437； UniProt 1–437 Author chain D； PDBConstruct 1–437； UniProt 1–437 Author chain E； PDBConstruct 1–437； UniProt 1–437 Author chain F； PDBConstruct 1–437； UniProt 1–437 Author chain G； PDBConstruct 1–437； UniProt 1–437 Author chain H； PDBConstruct 1–437； UniProt 1–437 Author chain I； PDBConstruct 1–437； UniProt 1–437 Author chain J； PDBConstruct 1–437； UniProt 1–437 Author chain K； PDBConstruct 1–437； UniProt 1–437 Author chain L； PDBConstruct 1–437； UniProt 1–437 Author chain M； PDBConstruct 1–437； UniProt 1–437 Author chain N； PDBConstruct 1–437； UniProt 1–437 Author chain O； PDBConstruct 1–437； UniProt 1–437

Flagellar M-ring protein

OrganismNot specified

UniProt Q75N27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75N27_VIBAL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AA； PDBConstruct 1–580； UniProt 1–580 Author chain AB； PDBConstruct 1–580； UniProt 1–580 Author chain AC； PDBConstruct 1–580； UniProt 1–580 Author chain AD； PDBConstruct 1–580； UniProt 1–580 Author chain AE； PDBConstruct 1–580； UniProt 1–580 Author chain AF； PDBConstruct 1–580； UniProt 1–580 Author chain AG； PDBConstruct 1–580； UniProt 1–580 Author chain AH； PDBConstruct 1–580； UniProt 1–580 Author chain AI； PDBConstruct 1–580； UniProt 1–580 Author chain AJ； PDBConstruct 1–580； UniProt 1–580 Author chain AK； PDBConstruct 1–580； UniProt 1–580 Author chain AL； PDBConstruct 1–580； UniProt 1–580 Author chain AM； PDBConstruct 1–580； UniProt 1–580 Author chain AN； PDBConstruct 1–580； UniProt 1–580 Author chain AO； PDBConstruct 1–580； UniProt 1–580 Author chain D1； PDBConstruct 1–580； UniProt 1–580 Author chain D2； PDBConstruct 1–580； UniProt 1–580 Author chain D3； PDBConstruct 1–580； UniProt 1–580 Author chain D4； PDBConstruct 1–580； UniProt 1–580 Author chain D5； PDBConstruct 1–580； UniProt 1–580 Author chain Dz； PDBConstruct 1–580； UniProt 1–580 Author chain E1； PDBConstruct 1–580； UniProt 1–580 Author chain E2； PDBConstruct 1–580； UniProt 1–580 Author chain E3； PDBConstruct 1–580； UniProt 1–580 Author chain E4； PDBConstruct 1–580； UniProt 1–580 Author chain E5； PDBConstruct 1–580； UniProt 1–580 Author chain EG； PDBConstruct 1–580； UniProt 1–580 Author chain EH； PDBConstruct 1–580； UniProt 1–580 Author chain EI； PDBConstruct 1–580； UniProt 1–580 Author chain EJ； PDBConstruct 1–580； UniProt 1–580 Author chain EK； PDBConstruct 1–580； UniProt 1–580 Author chain EL； PDBConstruct 1–580； UniProt 1–580 Author chain EM； PDBConstruct 1–580； UniProt 1–580 Author chain EN； PDBConstruct 1–580； UniProt 1–580 Author chain EO； PDBConstruct 1–580； UniProt 1–580 Author chain EP； PDBConstruct 1–580； UniProt 1–580 Author chain EQ； PDBConstruct 1–580； UniProt 1–580 Author chain ER； PDBConstruct 1–580； UniProt 1–580 Author chain ES； PDBConstruct 1–580； UniProt 1–580 Author chain ET； PDBConstruct 1–580； UniProt 1–580 Author chain EU； PDBConstruct 1–580； UniProt 1–580 Author chain EV； PDBConstruct 1–580； UniProt 1–580 Author chain EW； PDBConstruct 1–580； UniProt 1–580 Author chain EX； PDBConstruct 1–580； UniProt 1–580 Author chain EY； PDBConstruct 1–580； UniProt 1–580 Author chain EZ； PDBConstruct 1–580； UniProt 1–580 Author chain Ea； PDBConstruct 1–580； UniProt 1–580 Author chain Eb； PDBConstruct 1–580； UniProt 1–580 Author chain Ec； PDBConstruct 1–580； UniProt 1–580 Author chain Ed； PDBConstruct 1–580； UniProt 1–580 Author chain Ee； PDBConstruct 1–580； UniProt 1–580 Author chain Ef； PDBConstruct 1–580； UniProt 1–580 Author chain Eg； PDBConstruct 1–580； UniProt 1–580 Author chain Eh； PDBConstruct 1–580； UniProt 1–580 Author chain Ei； PDBConstruct 1–580； UniProt 1–580 Author chain Ej； PDBConstruct 1–580； UniProt 1–580 Author chain Ek； PDBConstruct 1–580； UniProt 1–580 Author chain El； PDBConstruct 1–580； UniProt 1–580 Author chain Em； PDBConstruct 1–580； UniProt 1–580 Author chain En； PDBConstruct 1–580； UniProt 1–580 Author chain Eo； PDBConstruct 1–580； UniProt 1–580 Author chain Ep； PDBConstruct 1–580； UniProt 1–580 Author chain Eq； PDBConstruct 1–580； UniProt 1–580 Author chain Er； PDBConstruct 1–580； UniProt 1–580 Author chain Es； PDBConstruct 1–580； UniProt 1–580 Author chain Et； PDBConstruct 1–580； UniProt 1–580 Author chain Eu； PDBConstruct 1–580； UniProt 1–580 Author chain Ev； PDBConstruct 1–580； UniProt 1–580 Author chain Ew； PDBConstruct 1–580； UniProt 1–580 Author chain Ex； PDBConstruct 1–580； UniProt 1–580 Author chain Ey； PDBConstruct 1–580； UniProt 1–580 Author chain Ez； PDBConstruct 1–580； UniProt 1–580

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt A0A0G9LZG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZG6_VIBAL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain b； PDBConstruct 1–131； UniProt 1–131 Author chain c； PDBConstruct 1–131； UniProt 1–131 Author chain d； PDBConstruct 1–131； UniProt 1–131 Author chain e； PDBConstruct 1–131； UniProt 1–131 Author chain f； PDBConstruct 1–131； UniProt 1–131

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt A0A0G9LZH2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZH2_VIBAL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain g； PDBConstruct 1–137； UniProt 1–137 Author chain h； PDBConstruct 1–137； UniProt 1–137 Author chain i； PDBConstruct 1–137； UniProt 1–137 Author chain j； PDBConstruct 1–137； UniProt 1–137 Author chain k； PDBConstruct 1–137； UniProt 1–137 Author chain l； PDBConstruct 1–137； UniProt 1–137

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt A0A0G9M4M9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9M4M9_VIBAL
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain m； PDBConstruct 1–249； UniProt 1–249 Author chain n； PDBConstruct 1–249； UniProt 1–249 Author chain o； PDBConstruct 1–249； UniProt 1–249 Author chain p； PDBConstruct 1–249； UniProt 1–249 Author chain q； PDBConstruct 1–249； UniProt 1–249

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt A0A0H0Y9C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0Y9C1_VIBAL
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain r； PDBConstruct 1–103； UniProt 1–103 Author chain s； PDBConstruct 1–103； UniProt 1–103 Author chain t； PDBConstruct 1–103； UniProt 1–103 Author chain u； PDBConstruct 1–103； UniProt 1–103 Author chain v； PDBConstruct 1–103； UniProt 1–103 Author chain w； PDBConstruct 1–103； UniProt 1–103

Flagellar biosynthetic protein FlhB

OrganismNot specified

UniProt A0A0H0YB55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YB55_VIBAL
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain x； PDBConstruct 1–376； UniProt 1–376

Flagella basal-body protein

OrganismNot specified

UniProt D9N551

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D9N551_VIBAL
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain A8； PDBConstruct 1–377； UniProt 1–377 Author chain B1； PDBConstruct 1–377； UniProt 1–377 Author chain B6； PDBConstruct 1–377； UniProt 1–377 Author chain B7； PDBConstruct 1–377； UniProt 1–377 Author chain BC； PDBConstruct 1–377； UniProt 1–377 Author chain BH； PDBConstruct 1–377； UniProt 1–377 Author chain BM； PDBConstruct 1–377； UniProt 1–377 Author chain BR； PDBConstruct 1–377； UniProt 1–377 Author chain BW； PDBConstruct 1–377； UniProt 1–377 Author chain Bb； PDBConstruct 1–377； UniProt 1–377 Author chain Bg； PDBConstruct 1–377； UniProt 1–377 Author chain Bl； PDBConstruct 1–377； UniProt 1–377 Author chain Bq； PDBConstruct 1–377； UniProt 1–377 Author chain Bv； PDBConstruct 1–377； UniProt 1–377 Author chain C3； PDBConstruct 1–377； UniProt 1–377 Author chain C8； PDBConstruct 1–377； UniProt 1–377 Author chain CB； PDBConstruct 1–377； UniProt 1–377 Author chain CJ； PDBConstruct 1–377； UniProt 1–377 Author chain CO； PDBConstruct 1–377； UniProt 1–377 Author chain CT； PDBConstruct 1–377； UniProt 1–377 Author chain CY； PDBConstruct 1–377； UniProt 1–377 Author chain Cd； PDBConstruct 1–377； UniProt 1–377 Author chain Ci； PDBConstruct 1–377； UniProt 1–377 Author chain Cn； PDBConstruct 1–377； UniProt 1–377 Author chain Cs； PDBConstruct 1–377； UniProt 1–377 Author chain Cx； PDBConstruct 1–377； UniProt 1–377

Flagellar assembly lipoprotein FlgP

OrganismNot specified

UniProt A0A0H0Y943

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0Y943_VIBAL
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain A0； PDBConstruct 1–143； UniProt 1–143 Author chain A5； PDBConstruct 1–143； UniProt 1–143 Author chain B3； PDBConstruct 1–143； UniProt 1–143 Author chain B9； PDBConstruct 1–143； UniProt 1–143 Author chain BE； PDBConstruct 1–143； UniProt 1–143 Author chain BJ； PDBConstruct 1–143； UniProt 1–143 Author chain BO； PDBConstruct 1–143； UniProt 1–143 Author chain BT； PDBConstruct 1–143； UniProt 1–143 Author chain BY； PDBConstruct 1–143； UniProt 1–143 Author chain Bd； PDBConstruct 1–143； UniProt 1–143 Author chain Bi； PDBConstruct 1–143； UniProt 1–143 Author chain Bn； PDBConstruct 1–143； UniProt 1–143 Author chain Bs； PDBConstruct 1–143； UniProt 1–143 Author chain Bx； PDBConstruct 1–143； UniProt 1–143 Author chain C0； PDBConstruct 1–143； UniProt 1–143 Author chain C5； PDBConstruct 1–143； UniProt 1–143 Author chain CD； PDBConstruct 1–143； UniProt 1–143 Author chain CL； PDBConstruct 1–143； UniProt 1–143 Author chain CQ； PDBConstruct 1–143； UniProt 1–143 Author chain CV； PDBConstruct 1–143； UniProt 1–143 Author chain Ca； PDBConstruct 1–143； UniProt 1–143 Author chain Cf； PDBConstruct 1–143； UniProt 1–143 Author chain Ck； PDBConstruct 1–143； UniProt 1–143 Author chain Cp； PDBConstruct 1–143； UniProt 1–143 Author chain Cu； PDBConstruct 1–143； UniProt 1–143 Author chain Cz； PDBConstruct 1–143； UniProt 1–143

Component of sodium-driven polar flagellar motor

OrganismNot specified

UniProt P74944

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Sodium-type flagellar motor component × 26 （Q93R25） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P74944_VIBAL
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain CG； PDBConstruct 1–293； UniProt 1–293 Author chain DA； PDBConstruct 1–293； UniProt 1–293 Author chain DD； PDBConstruct 1–293； UniProt 1–293 Author chain DE； PDBConstruct 1–293； UniProt 1–293 Author chain DH； PDBConstruct 1–293； UniProt 1–293 Author chain DI； PDBConstruct 1–293； UniProt 1–293 Author chain DL； PDBConstruct 1–293； UniProt 1–293 Author chain DM； PDBConstruct 1–293； UniProt 1–293 Author chain DP； PDBConstruct 1–293； UniProt 1–293 Author chain DQ； PDBConstruct 1–293； UniProt 1–293 Author chain DT； PDBConstruct 1–293； UniProt 1–293 Author chain DU； PDBConstruct 1–293； UniProt 1–293 Author chain DX； PDBConstruct 1–293； UniProt 1–293 Author chain DY； PDBConstruct 1–293； UniProt 1–293 Author chain Db； PDBConstruct 1–293； UniProt 1–293 Author chain Dc； PDBConstruct 1–293； UniProt 1–293 Author chain Df； PDBConstruct 1–293； UniProt 1–293 Author chain Dg； PDBConstruct 1–293； UniProt 1–293 Author chain Dj； PDBConstruct 1–293； UniProt 1–293 Author chain Dk； PDBConstruct 1–293； UniProt 1–293 Author chain Dn； PDBConstruct 1–293； UniProt 1–293 Author chain Do； PDBConstruct 1–293； UniProt 1–293 Author chain Dr； PDBConstruct 1–293； UniProt 1–293 Author chain Ds； PDBConstruct 1–293； UniProt 1–293 Author chain Dv； PDBConstruct 1–293； UniProt 1–293 Author chain Dw； PDBConstruct 1–293； UniProt 1–293

Sodium-type flagellar motor component

OrganismNot specified

UniProt Q93R25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 367	LRR × 2 Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal-body rod protein FlgG × 27 （A0A0H0YB44） Flagellar hook protein FlgE × 40 （A0A0H0YA78） Flagellar M-ring protein × 72 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagella basal-body protein × 26 （D9N551） FlgH × 26 Flagellar assembly lipoprotein FlgP × 26 （A0A0H0Y943） FlgH × 27 FlgI × 26 Component of sodium-driven polar flagellar motor × 26 （P74944） FlgB-Dc × 4 FliE-helix 1 × 6 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93R25_VIBAL
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain DB； PDBConstruct 1–211； UniProt 1–211 Author chain DC； PDBConstruct 1–211； UniProt 1–211 Author chain DF； PDBConstruct 1–211； UniProt 1–211 Author chain DG； PDBConstruct 1–211； UniProt 1–211 Author chain DJ； PDBConstruct 1–211； UniProt 1–211 Author chain DK； PDBConstruct 1–211； UniProt 1–211 Author chain DN； PDBConstruct 1–211； UniProt 1–211 Author chain DO； PDBConstruct 1–211； UniProt 1–211 Author chain DR； PDBConstruct 1–211； UniProt 1–211 Author chain DS； PDBConstruct 1–211； UniProt 1–211 Author chain DV； PDBConstruct 1–211； UniProt 1–211 Author chain DW； PDBConstruct 1–211； UniProt 1–211 Author chain DZ； PDBConstruct 1–211； UniProt 1–211 Author chain Da； PDBConstruct 1–211； UniProt 1–211 Author chain Dd； PDBConstruct 1–211； UniProt 1–211 Author chain De； PDBConstruct 1–211； UniProt 1–211 Author chain Dh； PDBConstruct 1–211； UniProt 1–211 Author chain Di； PDBConstruct 1–211； UniProt 1–211 Author chain Dl； PDBConstruct 1–211； UniProt 1–211 Author chain Dm； PDBConstruct 1–211； UniProt 1–211 Author chain Dp； PDBConstruct 1–211； UniProt 1–211 Author chain Dq； PDBConstruct 1–211； UniProt 1–211 Author chain Dt； PDBConstruct 1–211； UniProt 1–211 Author chain Du； PDBConstruct 1–211； UniProt 1–211 Author chain Dx； PDBConstruct 1–211； UniProt 1–211 Author chain Dy； PDBConstruct 1–211； UniProt 1–211

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8z60
Deposition date deposition_date	2024-04-18
Structure title title	Cryo-EM structure of the polar flagellar motor-hook complex
Keywords keywords	Polar flagellum, Polar flagellar motor, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8z60__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8z60__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8z60__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	150.80 Å
Total Rg	150.70 Å
Atom count	555596
Residues	72074
Excluded volume	9797700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8z60__assembly_1__model_1`	367-meric （367）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	LRR
Molecular weight formula_weight	21518.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,9
Atom count atom_count	555596

MRFVSLFLTLMLLCFPSFAYELDYYSKFGHTDNYGNLDLRNKPYTQLPSGFVVKGNLNISQTPIKKLPKGLDVGGSLEATNSALKTIRSGTKIKGYANLLGSKIESWPRGIKLGGYLNLTDTPLKTLPAKLRVKGDLSVIRTPISALPEGLVVDGNLYIGGSALQVFPDTMTVKGNIFLGGNKITKWPSNLTLGGAVAP

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	31314.9 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,y,z

MTKGNPIRLLLSTLLLFVGVLFSSFSFAEAEESALPDNLADGSSVTVQAMQSDTGASRAMSVSSGGGIPAFTMTTNPDGSEDYSVTLQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIALFLTFFVMSPVLNEINDKAVQPYLNEQVTAREAFDAAQAPMKAFMLKQTRIKDLETFVTMSGEQVDNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSFAL

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	10329.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,5,6,7

MTPEMFVELFREALWMVLIMVCAIIIPSLLIGLIVAIFQAATSINEQTLSFLPRLIVTLLALMLFGHWMTQMLMEYFYGLIERLPQVLY

Entity 4 Entity 4 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28905.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MEYPTSVVLDWIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPQDIELLSFRGFMTIAEQMIIGIAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQLFMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNAVDFREMAGWLGIMFQTALSMSLSGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILAGLYSHYEMFWTVGEAQICRLIRLEC

Entity 5 Entity 5 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27908.9 kDa
Source method src_method	nat
Copy count entity_count	27

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,AP,AQ,AR,AS,AT,AU,AV,AW,AX,AY,AZ,Aa,B,C,P,Q,R,S,T,U,V,W,X,Y,Z,a

MHPALWVSKTGLDAQQTNIATISNNLANASTVGYKKSRAVFEDLFYQNINQPGGQSSQNTELPSGLMLGAGSKVVATQKVHTHGNAQTTTNALDMMVEGDGFFQVTLPDGNIGYTRNGQFTLNGEGTLVTSGSGYPVEPEIVIPEDAISITVGTDGEVSVRVRGQQDNQVVGQLTITDFVNPGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGEIRQSMLEASNVNVTEELVNMIEAQRVYEMNSKVISSVDKMMSFVNQQL

Entity 6 Entity 6 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	47434.4 kDa
Source method src_method	nat
Copy count entity_count	40

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A2,A3,Ab,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao,Ap,Aq,Ar,As,At,Au,Av,Aw,Ax,Ay,Az,D,E,F,G,H,I,J,K,L,M,N,O

MSYVSLSGLSAAQLDLNTTSNNIANANTYGFKESRAEFADVYSNSLFTNAKTTPGGGAQASQVAQQFHEGSSIYTNNPMDLRVSGTGFFAVAKERLTPQQNELTRNGAFHLNKENYMVTANDEFLLGYQVDPSSGEVSSYEPQPINIPAEFGKPKQTANIEVGVNLPANGDLKDPTQFDFSDPDTYNRSTSSTIYDSMGQSYKLTTYYLKDQTQPNTWNTYYTVTDKEGEKPLNVAAGDAQTPTGHVGHTMKFNNDGTLASLNNGQPITSVALGDPATNTTPVDMNGADPAQTLNFGLGSATQFAAPFELTKFDEDGATTGFLTKVDFDENGSVMGTYSNGENVTLGRVALVRVPNEQGLDKKGGTQWDSTQFSGDKIWGESNKGSFGTINNGMLEQSNIDMTQELVDLISAQRNFQANSRSLEVHNQLQQNILQIR

Entity 7 Entity 7 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	63915.6 kDa
Source method src_method	nat
Copy count entity_count	72

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,Dz,D1,D2,D3,D4,D5,EG,EH,EI,EJ,EK,EL,EM,EN,EO,EP,EQ,ER,ES,ET,EU,EV,EW,EX,EY,EZ,Ea,Eb,Ec,Ed,Ee,Ef,Eg,Eh,Ei,Ej,Ek,El,Em,En,Eo,Ep,Eq,Er,Es,Et,Eu,Ev,Ew,Ex,Ey,Ez,E1,E2,E3,E4,E5 ;

MADKSTDLTVTEGGSDGALVASSDVDVESQNPDLEERSASKFDMAVGDLDLLRQVVLVLSISICVALIVMLFFWVKEPEMRPLGAYETEELIPVLDYLDQQKINYKLDGNTISVESSEYNSIKLGMVRSGVNQATEAGDDILLQDMGFGVSQRLEQERLKLSRERQLAQAIEEMKQVRKARVLLALPKHSVFVRHNQEASASVFLTLSTGTNLKQQEVDSIVDMVASAVPGMKTSRITVTDQHGRLLSSGSQDPASAARRKEQELERSQEQALREKIDSVLLPILGYGNYTAQVDIQMDFSAVEQTRKRFDPNTPATRSEYALEDYNNGNMVAGIPGALSNQPPADASIPQDVAQMKDGSVMGQGSVRKESTRNFELDTTISHERKQTGTVARQTVSVAIKDRRQVNPDTGEVTYTPMSESEINAIRQVLIGTVGFDQGRGDLLNVLSVKFAEPEAEQLEEPPIWEHPNFSDWVRWFASALVIIVVVLVLVRPAMKKLLNPTSDDEDEMYGPDGLPIGADGETSLIGSDIESSELFEFGSSIDLPNLHKDEDVLKAVRALVANEPELAAQVVKNWMNDNG

Entity 8 Entity 8 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	14240.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c,d,e,f

MAISFDNALGIHQHTVGVRERNAEVISTNIAQANTPGYKARGLDFAKELQAATSGASIGLSRTDGRHIPATTTLVGDKLYRLPTQPDTGDGNTVDLDLERNLFMQNQIRHQASLDFLGSKFKNLTKAIKGE

Entity 9 Entity 9 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	14812.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l

MSLFNVFNVTGSAMSAESVRLNTTSSNLANADSVSSSAKDTYKARHAVFGAELSNAMRGGDTVPVKVMGIVESDKPLSAEYNPDHPLANEEGYIYKPNVNVMEEMANMISASRAYQTNVQVADSSKQMLLRTLQMGQ

Entity 10 Entity 10 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26987.4 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,n,o,p,q

MDRALFLAMSGAKQNMQALQLRANNLANVSTTGFRADLAQARSMQAYGEGHPSRVFSMTERPGHNFAQGSVITTGRDLDVTIEGSGWISVLDHTGKEGLTRNGNLKVDQNGMLTNASGHLVLGENDAPITLPIPLSKIEIGRDGTISVLPQGAPAEEFQAVDRIKLVKPNDQSLFKDTNGLFRHKTPNQPYEADATVSLQTGAIEGSNVNAVGEMTALIDLQRQFEMQVKMMSTAEEMDKSSDSLLRMS

Entity 11 Entity 11 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11135.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r,s,t,u,v,w

MKVDGIQAEMRAMMVEATNTAPTASGAKVGADFNDLLTKAINNVNTLQKASGDLQTRFDRGDADVSLSDVMIARNKSSVAFDATVQIRNKLVEAYKDLMNMPV

Entity 12 Entity 12 polymer

Description description	Flagellar biosynthetic protein FlhB
Molecular weight formula_weight	42197.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MAESDGQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAISLMWFGEALARSLFSIMSRLFDLQREEIFDTAKLFDIALGAMTDLLFPLFLVLATLFTAAMIGAAGVGGISFSAQAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLVTGVAIYLIQASQADLIQLSMDVYPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKPEVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQKTDRAPVVIAKGTDHMAMKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLKQYRKRGGQRPKIQDYDLPIPPEHRH

Entity 13 Entity 13 polymer

Description description	Flagella basal-body protein
Molecular weight formula_weight	42417.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B7,CB,CJ,A8,CO,CT,CY,Cd,Ci,Cn,Cs,Cx,C3,C8,B1,B6,BC,BH,BM,BR,BW,Bb,Bg,Bl,Bq,Bv

MKKILNSLFSITLVMLVPFKVMASWYEVTGVATIVSSEETARLHALEDALFKAVNFSGADIGSISNLMPLLEESRNEYQFTNHEVRYILVESERKRRGKVEVKIRVDIYPSATGCHTDQYKKTILVGNIEVASPQQAVMGQIYQVGDDFSRVVNRQLDQTSRSFVSVGTTDYSISSNYPARTQMIAQDNGAQYIIGGVITDLTATVESQLLQDDIINRQFALEMKVFDGKTGHEVFNKAYREVARWPFAKTSQVDTRSARFWASTYGEMMLRVSRNIMLDLESELSCKITLPEVVAVFGNTVTMDLGRMHGVKEGDKLQLWHTASFIDQNGLPRNKVSQSEITLTVSRIYEHEAELTIDQPNLASSVQIGDVMNKIL

Entity 14 Entity 14 polymer

Description description	FlgH
Molecular weight formula_weight	27930.0 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B8,CC,A4,A9,CK,CP,CU,CZ,Ce,Cj,Co,Ct,Cy,C4,C9,B2,BD,BI,BN,BS,BX,Bc,Bh,Bm,Br,Bw

MKRICLLALIATMSGCAMLEPIETDEVTQATTVVDAVEGDKSKEESSGIVDTLRGRSDPVAGDPAWAPIHPKKKPEHYAAATGSLFSAEHITDLYDDSKPRGIGDIITVTLDETTSATKSANADLSKTNEAQMDPLQVGGEELQIGGKYNFSYDLNNSNSFAGDSSAKQSNSISGYITVEVIEVLANGNLVIRGEKWMTLNTGDEYIRLSGTIRPDDISFDNTIASNRVSNARIQYSGTGVQQDMQEPGFLARFFNVAL

Entity 15 Entity 15 polymer

Description description	Flagellar assembly lipoprotein FlgP
Molecular weight formula_weight	16303.8 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B9,CD,A0,A5,CL,CQ,CV,Ca,Cf,Ck,Cp,Cu,Cz,C5,C0,B3,BE,BJ,BO,BT,BY,Bd,Bi,Bn,Bs,Bx

MKKLLFIVATLILVGCQPLQQMRQDEILVAVGYASVSEQTGRTVEEKRVRAMRASKIDAYRELAEQVYGMRVSGRAELQDQRLGIESTTGAVDGVIRGAEVVRSYLVEDSYVTELRLDIRKMDKLRDYGEVQQVPEKRQQTLF

Entity 16 Entity 16 polymer

Description description	FlgH
Molecular weight formula_weight	1450.6 kDa
Source method src_method	nat
Copy count entity_count	27

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B0,CE,CH,A6,CM,CR,CW,Cb,Cg,Cl,Cq,Cv,C1,C6,B4,BA,BF,BK,BP,BU,BZ,Be,Bj,Bo,Bt,By,D0

CAMLEPIETDEVT

Entity 17 Entity 17 polymer

Description description	FlgI
Molecular weight formula_weight	37892.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CA,CF,CI,A7,CN,CS,CX,Cc,Ch,Cm,Cr,Cw,C2,C7,B5,BB,BG,BL,BQ,BV,Ba,Bf,Bk,Bp,Bu,Bz

MKKLLLILMSVALFSTAAQAARIKDVAQVAGVRSNQLVGYGLVSGLPGTGEANPFTEQSFAAMLQNFGIQMPPGTKPKIKNVAAVMVTAELPPFSKPGQQVDVTVSSIGSAKSLRGGTLLQTFLKGLDGQVYAVAQGNLVVSGFSAEGADGSKIVGNNPTVGLISSGATVEREIPNPFGRGDYITFNLLESDFTTAQRMADAVNNFLGPQMASAVDATSVRVRAPRDVSQRVAFLSAIENLEFDPADGAAKIIVNSRTGTIVVGKHVRLKPAAVTHGGMTVAIKENLNVSQPNGFSGGQTVVVPDSDIEVSEEQGKMFKFEPGLTLDDLVRAVNQVGAAPSDLMAILQALKQAGAIEGQLIII

Entity 18 Entity 18 polymer

Description description	Component of sodium-driven polar flagellar motor
Molecular weight formula_weight	33528.0 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CG,DA,DD,DE,DH,DI,DL,DM,DP,DQ,DT,DU,DX,DY,Db,Dc,Df,Dg,Dj,Dk,Dn,Do,Dr,Ds,Dv,Dw

MKKWLITSGVVFSLFSTSSFAVMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDGKSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGKRRPIADNGSPIGKDKNRRVVISLGRTQV

Entity 19 Entity 19 polymer

Description description	Sodium-type flagellar motor component
Molecular weight formula_weight	24088.6 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DB,DC,DF,DG,DJ,DK,DN,DO,DR,DS,DV,DW,DZ,Da,Dd,De,Dh,Di,Dl,Dm,Dp,Dq,Dt,Du,Dx,Dy

MKLRTVAASLLLTLVATTAKANVADVGAPVPIYTEAELIKLIEQNKHLQRVRADNCQLVEDIVARATRINLPAYEFLYGDMLAWGVCVEQDVELGLYYIENAAHQGLPAALEQIGRYYSRGTLVQQDKERAIPYLREAASMGNLNARIHLAELLLRDYGSPLDYEDAYRWLYNSVTADKRQHKRITVLRNGLEQRMPQNVIARAKRRDTFW

Entity 20 Entity 20 polymer

Description description	FlgB-Dc
Molecular weight formula_weight	1395.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D6,D7,D8,D9

IGLSRTDGRHIPA

Entity 21 Entity 21 polymer

Description description	FliE-helix 1
Molecular weight formula_weight	1867.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	EA,EB,EC,ED,EE,EF

VDGIQAEMRAMMVEATN

Entity 22 Entity 22 non-polymer

Description description	(1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE
Molecular weight formula_weight	751.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 23 Entity 23 non-polymer

Description description	(11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate
Molecular weight formula_weight	495.6 kDa
Source method src_method	syn
Copy count entity_count	5

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.22 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	61395

Cryo-EM structure of the polar flagellar motor-hook complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer