SAXSdb — 8z5w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leucine-rich repeat protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar basal-body rod protein FlgG × 6 （A0A0H0YB44） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9W4FN72_VIBAL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–199； UniProt 1–199 Author chain 9； PDBConstruct 1–199； UniProt 1–199

Flagellar basal-body rod protein FlgG

OrganismNot specified

UniProt A0A0H0YB44

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Leucine-rich repeat protein × 2 （A0A9W4FN72） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YB44_VIBAL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–262； UniProt 1–262 Author chain AP； PDBConstruct 1–262； UniProt 1–262 Author chain AQ； PDBConstruct 1–262； UniProt 1–262 Author chain AR； PDBConstruct 1–262； UniProt 1–262 Author chain B； PDBConstruct 1–262； UniProt 1–262 Author chain C； PDBConstruct 1–262； UniProt 1–262

Flagellar M-ring protein

OrganismNot specified

UniProt Q75N27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Leucine-rich repeat protein × 2 （A0A9W4FN72） Flagellar basal-body rod protein FlgG × 6 （A0A0H0YB44） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75N27_VIBAL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AA； PDBConstruct 1–580； UniProt 1–580 Author chain AB； PDBConstruct 1–580； UniProt 1–580 Author chain AC； PDBConstruct 1–580； UniProt 1–580 Author chain AD； PDBConstruct 1–580； UniProt 1–580 Author chain AE； PDBConstruct 1–580； UniProt 1–580 Author chain AF； PDBConstruct 1–580； UniProt 1–580 Author chain AG； PDBConstruct 1–580； UniProt 1–580 Author chain AH； PDBConstruct 1–580； UniProt 1–580 Author chain AI； PDBConstruct 1–580； UniProt 1–580 Author chain AJ； PDBConstruct 1–580； UniProt 1–580 Author chain AK； PDBConstruct 1–580； UniProt 1–580 Author chain AL； PDBConstruct 1–580； UniProt 1–580 Author chain AM； PDBConstruct 1–580； UniProt 1–580 Author chain AN； PDBConstruct 1–580； UniProt 1–580 Author chain AO； PDBConstruct 1–580； UniProt 1–580

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt A0A0G9LZG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Leucine-rich repeat protein × 2 （A0A9W4FN72） Flagellar basal-body rod protein FlgG × 6 （A0A0H0YB44） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZG6_VIBAL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain b； PDBConstruct 1–131； UniProt 1–131 Author chain c； PDBConstruct 1–131； UniProt 1–131 Author chain d； PDBConstruct 1–131； UniProt 1–131 Author chain e； PDBConstruct 1–131； UniProt 1–131 Author chain f； PDBConstruct 1–131； UniProt 1–131

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt A0A0G9LZH2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Leucine-rich repeat protein × 2 （A0A9W4FN72） Flagellar basal-body rod protein FlgG × 6 （A0A0H0YB44） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZH2_VIBAL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain g； PDBConstruct 1–137； UniProt 1–137 Author chain h； PDBConstruct 1–137； UniProt 1–137 Author chain i； PDBConstruct 1–137； UniProt 1–137 Author chain j； PDBConstruct 1–137； UniProt 1–137 Author chain k； PDBConstruct 1–137； UniProt 1–137 Author chain l； PDBConstruct 1–137； UniProt 1–137

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt A0A0G9M4M9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Leucine-rich repeat protein × 2 （A0A9W4FN72） Flagellar basal-body rod protein FlgG × 6 （A0A0H0YB44） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9M4M9_VIBAL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain m； PDBConstruct 1–249； UniProt 1–249 Author chain n； PDBConstruct 1–249； UniProt 1–249 Author chain o； PDBConstruct 1–249； UniProt 1–249 Author chain p； PDBConstruct 1–249； UniProt 1–249 Author chain q； PDBConstruct 1–249； UniProt 1–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8z5w
Deposition date deposition_date	2024-04-18
Structure title title	Cryo-EM structure of the LRR protein within the polar flagellar motor
Keywords keywords	Polar flagellum, Polar flagellar motor, LRR, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8z5w__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8z5w__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8z5w__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.09 Å
Rg (electron density)	52.90 Å
Total Rg	52.98 Å
Atom count	36128
Residues	4810
Excluded volume	637390 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8z5w__assembly_1__model_1`	39-meric （39）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Leucine-rich repeat protein
Molecular weight formula_weight	21518.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,9
Atom count atom_count	36128

MRFVSLFLTLMLLCFPSFAYELDYYSKFGHTDNYGNLDLRNKPYTQLPSGFVVKGNLNISQTPIKKLPKGLDVGGSLEATNSALKTIRSGTKIKGYANLLGSKIESWPRGIKLGGYLNLTDTPLKTLPAKLRVKGDLSVIRTPISALPEGLVVDGNLYIGGSALQVFPDTMTVKGNIFLGGNKITKWPSNLTLGGAVAP

Entity 2 Entity 2 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27908.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,AP,AQ,AR

MHPALWVSKTGLDAQQTNIATISNNLANASTVGYKKSRAVFEDLFYQNINQPGGQSSQNTELPSGLMLGAGSKVVATQKVHTHGNAQTTTNALDMMVEGDGFFQVTLPDGNIGYTRNGQFTLNGEGTLVTSGSGYPVEPEIVIPEDAISITVGTDGEVSVRVRGQQDNQVVGQLTITDFVNPGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGEIRQSMLEASNVNVTEELVNMIEAQRVYEMNSKVISSVDKMMSFVNQQL

Entity 3 Entity 3 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	63915.6 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO

MADKSTDLTVTEGGSDGALVASSDVDVESQNPDLEERSASKFDMAVGDLDLLRQVVLVLSISICVALIVMLFFWVKEPEMRPLGAYETEELIPVLDYLDQQKINYKLDGNTISVESSEYNSIKLGMVRSGVNQATEAGDDILLQDMGFGVSQRLEQERLKLSRERQLAQAIEEMKQVRKARVLLALPKHSVFVRHNQEASASVFLTLSTGTNLKQQEVDSIVDMVASAVPGMKTSRITVTDQHGRLLSSGSQDPASAARRKEQELERSQEQALREKIDSVLLPILGYGNYTAQVDIQMDFSAVEQTRKRFDPNTPATRSEYALEDYNNGNMVAGIPGALSNQPPADASIPQDVAQMKDGSVMGQGSVRKESTRNFELDTTISHERKQTGTVARQTVSVAIKDRRQVNPDTGEVTYTPMSESEINAIRQVLIGTVGFDQGRGDLLNVLSVKFAEPEAEQLEEPPIWEHPNFSDWVRWFASALVIIVVVLVLVRPAMKKLLNPTSDDEDEMYGPDGLPIGADGETSLIGSDIESSELFEFGSSIDLPNLHKDEDVLKAVRALVANEPELAAQVVKNWMNDNG

Entity 4 Entity 4 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	14240.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c,d,e,f

MAISFDNALGIHQHTVGVRERNAEVISTNIAQANTPGYKARGLDFAKELQAATSGASIGLSRTDGRHIPATTTLVGDKLYRLPTQPDTGDGNTVDLDLERNLFMQNQIRHQASLDFLGSKFKNLTKAIKGE

Entity 5 Entity 5 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	14812.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l

MSLFNVFNVTGSAMSAESVRLNTTSSNLANADSVSSSAKDTYKARHAVFGAELSNAMRGGDTVPVKVMGIVESDKPLSAEYNPDHPLANEEGYIYKPNVNVMEEMANMISASRAYQTNVQVADSSKQMLLRTLQMGQ

Entity 6 Entity 6 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26987.4 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,n,o,p,q

MDRALFLAMSGAKQNMQALQLRANNLANVSTTGFRADLAQARSMQAYGEGHPSRVFSMTERPGHNFAQGSVITTGRDLDVTIEGSGWISVLDHTGKEGLTRNGNLKVDQNGMLTNASGHLVLGENDAPITLPIPLSKIEIGRDGTISVLPQGAPAEEFQAVDRIKLVKPNDQSLFKDTNGLFRHKTPNQPYEADATVSLQTGAIEGSNVNAVGEMTALIDLQRQFEMQVKMMSTAEEMDKSSDSLLRMS

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.46 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	19450

Cryo-EM structure of the LRR protein within the polar flagellar motor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leucine-rich repeat protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8z5w__assembly_1__model_1

8z5w__assembly_1__model_1 | I(q)

8z5w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)