8z5s

Cryo-EM structure of the proximal rod-export apparatus of the polar flagellar motor

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1W6TTE6_VIBAL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–289； UniProt 1–289 Author chain 2； PDBConstruct 1–289； UniProt 1–289 Author chain 3； PDBConstruct 1–289； UniProt 1–289 Author chain y； PDBConstruct 1–289； UniProt 1–289 Author chain z； PDBConstruct 1–289； UniProt 1–289

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt A0A0H0YAF4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YAF4_VIBAL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 4； PDBConstruct 1–89； UniProt 1–89 Author chain 5； PDBConstruct 1–89； UniProt 1–89 Author chain 6； PDBConstruct 1–89； UniProt 1–89 Author chain 7； PDBConstruct 1–89； UniProt 1–89

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt A0A0G9M4M9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9M4M9_VIBAL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain m； PDBConstruct 1–249； UniProt 1–249 Author chain n； PDBConstruct 1–249； UniProt 1–249 Author chain o； PDBConstruct 1–249； UniProt 1–249 Author chain p； PDBConstruct 1–249； UniProt 1–249 Author chain q； PDBConstruct 1–249； UniProt 1–249

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt A0A0H0Y9C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0Y9C1_VIBAL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain r； PDBConstruct 1–103； UniProt 1–103 Author chain s； PDBConstruct 1–103； UniProt 1–103 Author chain t； PDBConstruct 1–103； UniProt 1–103 Author chain u； PDBConstruct 1–103； UniProt 1–103 Author chain v； PDBConstruct 1–103； UniProt 1–103 Author chain w； PDBConstruct 1–103； UniProt 1–103

Flagellar biosynthetic protein FlhB

OrganismNot specified

UniProt A0A0H0YB55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YB55_VIBAL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain x； PDBConstruct 1–376； UniProt 1–376

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt A0A0H0YFV7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H0YFV7_VIBAL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 8； PDBConstruct 1–260； UniProt 1–260

Flagellar M-ring protein

OrganismNot specified

UniProt Q75N27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75N27_VIBAL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AA； PDBConstruct 1–580； UniProt 1–580 Author chain AB； PDBConstruct 1–580； UniProt 1–580 Author chain AC； PDBConstruct 1–580； UniProt 1–580 Author chain AD； PDBConstruct 1–580； UniProt 1–580 Author chain AE； PDBConstruct 1–580； UniProt 1–580 Author chain AF； PDBConstruct 1–580； UniProt 1–580 Author chain AG； PDBConstruct 1–580； UniProt 1–580 Author chain AH； PDBConstruct 1–580； UniProt 1–580 Author chain AI； PDBConstruct 1–580； UniProt 1–580 Author chain AJ； PDBConstruct 1–580； UniProt 1–580 Author chain AK； PDBConstruct 1–580； UniProt 1–580 Author chain AL； PDBConstruct 1–580； UniProt 1–580 Author chain AM； PDBConstruct 1–580； UniProt 1–580 Author chain AN； PDBConstruct 1–580； UniProt 1–580 Author chain AO； PDBConstruct 1–580； UniProt 1–580

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt A0A0G9LZG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal-body rod protein FlgC × 6 （A0A0G9LZH2） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZG6_VIBAL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain b； PDBConstruct 1–131； UniProt 1–131 Author chain c； PDBConstruct 1–131； UniProt 1–131 Author chain d； PDBConstruct 1–131； UniProt 1–131 Author chain e； PDBConstruct 1–131； UniProt 1–131 Author chain f； PDBConstruct 1–131； UniProt 1–131

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt A0A0G9LZH2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Flagellar biosynthetic protein FliP × 5 （A0A1W6TTE6） Flagellar biosynthetic protein FliQ × 4 （A0A0H0YAF4） Flagellar basal-body rod protein FlgF × 5 （A0A0G9M4M9） Flagellar hook-basal body complex protein FliE × 6 （A0A0H0Y9C1） Flagellar biosynthetic protein FlhB × 1 （A0A0H0YB55） Flagellar biosynthetic protein FliR × 1 （A0A0H0YFV7） Flagellar M-ring protein × 15 （Q75N27） Flagellar basal body rod protein FlgB × 5 （A0A0G9LZG6） (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 4 (11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G9LZH2_VIBAL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain g； PDBConstruct 1–137； UniProt 1–137 Author chain h； PDBConstruct 1–137； UniProt 1–137 Author chain i； PDBConstruct 1–137； UniProt 1–137 Author chain j； PDBConstruct 1–137； UniProt 1–137 Author chain k； PDBConstruct 1–137； UniProt 1–137 Author chain l； PDBConstruct 1–137； UniProt 1–137

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8z5s
Deposition date deposition_date	2024-04-18
Structure title title	Cryo-EM structure of the proximal rod-export apparatus of the polar flagellar motor
Keywords keywords	Polar flagellum, Polar flagellar motor, Proximal rod, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8z5s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8z5s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8z5s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	63.80 Å
Rg (electron density)	65.43 Å
Total Rg	65.22 Å
Atom count	38700
Residues	5016
Excluded volume	696060 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8z5s__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	31314.9 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,y,z
Atom count atom_count	38700

MTKGNPIRLLLSTLLLFVGVLFSSFSFAEAEESALPDNLADGSSVTVQAMQSDTGASRAMSVSSGGGIPAFTMTTNPDGSEDYSVTLQILALMTMLGFLPAMVILMTSFTRIVVVMSILRQAMGLQQTPSNQVIIGIALFLTFFVMSPVLNEINDKAVQPYLNEQVTAREAFDAAQAPMKAFMLKQTRIKDLETFVTMSGEQVDNPEDVSMAVLIPAFITSELKTAFQIGFMLFLPFLIIDLVVASVLMAMGMMMLSPMIVSLPFKLMLFVLVDGWNLILSTLAGSFAL

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	10329.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,5,6,7

MTPEMFVELFREALWMVLIMVCAIIIPSLLIGLIVAIFQAATSINEQTLSFLPRLIVTLLALMLFGHWMTQMLMEYFYGLIERLPQVLY

Entity 3 Entity 3 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26987.4 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,n,o,p,q

MDRALFLAMSGAKQNMQALQLRANNLANVSTTGFRADLAQARSMQAYGEGHPSRVFSMTERPGHNFAQGSVITTGRDLDVTIEGSGWISVLDHTGKEGLTRNGNLKVDQNGMLTNASGHLVLGENDAPITLPIPLSKIEIGRDGTISVLPQGAPAEEFQAVDRIKLVKPNDQSLFKDTNGLFRHKTPNQPYEADATVSLQTGAIEGSNVNAVGEMTALIDLQRQFEMQVKMMSTAEEMDKSSDSLLRMS

Entity 4 Entity 4 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11135.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r,s,t,u,v,w

MKVDGIQAEMRAMMVEATNTAPTASGAKVGADFNDLLTKAINNVNTLQKASGDLQTRFDRGDADVSLSDVMIARNKSSVAFDATVQIRNKLVEAYKDLMNMPV

Entity 5 Entity 5 polymer

Description description	Flagellar biosynthetic protein FlhB
Molecular weight formula_weight	42197.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MAESDGQERTEEATPRRLQQAREKGQVARSKELASASVLIVGAISLMWFGEALARSLFSIMSRLFDLQREEIFDTAKLFDIALGAMTDLLFPLFLVLATLFTAAMIGAAGVGGISFSAQAAMPKLSKMNPLSGLKRMVGMQSWVELIKSILKVVLVTGVAIYLIQASQADLIQLSMDVYPQNIFHALDILLNFILLISCSLLIVVAIDIPFQIWQHADQLKMTKQEVKDEYKETEGKPEVKGRIRMLQREAAQRRMMADVPQADVIVTNPEHFSVALRYKQKTDRAPVVIAKGTDHMAMKIREVAREHDITIVPAPPLARALYHTTELEQEIPDGLFTAVAQVLAFVFQLKQYRKRGGQRPKIQDYDLPIPPEHRH

Entity 6 Entity 6 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28905.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MEYPTSVVLDWIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPQDIELLSFRGFMTIAEQMIIGIAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQLFMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNAVDFREMAGWLGIMFQTALSMSLSGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILAGLYSHYEMFWTVGEAQICRLIRLEC

Entity 7 Entity 7 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	63915.6 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO

MADKSTDLTVTEGGSDGALVASSDVDVESQNPDLEERSASKFDMAVGDLDLLRQVVLVLSISICVALIVMLFFWVKEPEMRPLGAYETEELIPVLDYLDQQKINYKLDGNTISVESSEYNSIKLGMVRSGVNQATEAGDDILLQDMGFGVSQRLEQERLKLSRERQLAQAIEEMKQVRKARVLLALPKHSVFVRHNQEASASVFLTLSTGTNLKQQEVDSIVDMVASAVPGMKTSRITVTDQHGRLLSSGSQDPASAARRKEQELERSQEQALREKIDSVLLPILGYGNYTAQVDIQMDFSAVEQTRKRFDPNTPATRSEYALEDYNNGNMVAGIPGALSNQPPADASIPQDVAQMKDGSVMGQGSVRKESTRNFELDTTISHERKQTGTVARQTVSVAIKDRRQVNPDTGEVTYTPMSESEINAIRQVLIGTVGFDQGRGDLLNVLSVKFAEPEAEQLEEPPIWEHPNFSDWVRWFASALVIIVVVLVLVRPAMKKLLNPTSDDEDEMYGPDGLPIGADGETSLIGSDIESSELFEFGSSIDLPNLHKDEDVLKAVRALVANEPELAAQVVKNWMNDNG

Entity 8 Entity 8 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	14240.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c,d,e,f

MAISFDNALGIHQHTVGVRERNAEVISTNIAQANTPGYKARGLDFAKELQAATSGASIGLSRTDGRHIPATTTLVGDKLYRLPTQPDTGDGNTVDLDLERNLFMQNQIRHQASLDFLGSKFKNLTKAIKGE

Entity 9 Entity 9 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	14812.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l

MSLFNVFNVTGSAMSAESVRLNTTSSNLANADSVSSSAKDTYKARHAVFGAELSNAMRGGDTVPVKVMGIVESDKPLSAEYNPDHPLANEEGYIYKPNVNVMEEMANMISASRAYQTNVQVADSSKQMLLRTLQMGQ

Entity 10 Entity 10 non-polymer

Description description	(1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE
Molecular weight formula_weight	751.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 11 Entity 11 non-polymer

Description description	(11R,14S)-17-amino-14-hydroxy-8,14-dioxo-9,13,15-trioxa-14lambda~5~-phosphaheptadecan-11-yl decanoate
Molecular weight formula_weight	495.6 kDa
Source method src_method	syn
Copy count entity_count	5

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.03 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	58418

Cryo-EM structure of the proximal rod-export apparatus of the polar flagellar motor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FlhB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8z5s__assembly_1__model_1

8z5s__assembly_1__model_1 | I(q)

8z5s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment