9fnz

PF30S-PF30S dimer mediated by aRDF from P. furiosus (Structure II)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-binding protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5C0XRZ8_PYRFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A1； PDBConstruct 1–60； UniProt 1–60 Author chain B1； PDBConstruct 1–60； UniProt 1–60

Small ribosomal subunit protein eS32

OrganismNot specified

UniProt Q8U232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS32_PYRFU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A2； PDBConstruct 1–37； UniProt 1–37 Author chain B2； PDBConstruct 1–37； UniProt 1–37

Archaeal Ribosome Dimerizing Factor (aRDF)

Pyrococcus furiosus

UniProt Q8U3B0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U3B0_PYRFU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A3； PDBConstruct 1–300； UniProt 1–300 Author chain A4； PDBConstruct 1–300； UniProt 1–300 Author chain B3； PDBConstruct 1–300； UniProt 1–300 Author chain B4； PDBConstruct 1–300； UniProt 1–300

Large ribosomal subunit protein eL8

OrganismNot specified

UniProt Q8U160

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_PYRFU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A5； PDBConstruct 1–123； UniProt 1–123 Author chain B5； PDBConstruct 1–123； UniProt 1–123

Small ribosomal subunit protein uS2

OrganismNot specified

UniProt Q8U0F0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS2_PYRFU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AB； PDBConstruct 1–202； UniProt 1–202 Author chain BB； PDBConstruct 1–202； UniProt 1–202

Small ribosomal subunit protein uS3

OrganismNot specified

UniProt Q8U004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3_PYRFU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AC； PDBConstruct 1–210； UniProt 1–210 Author chain BC； PDBConstruct 1–210； UniProt 1–210

Small ribosomal subunit protein eS1

OrganismNot specified

UniProt Q8TZE1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3A_PYRFU
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AD； PDBConstruct 1–198； UniProt 1–198 Author chain BD； PDBConstruct 1–198； UniProt 1–198

Small ribosomal subunit protein uS4

OrganismNot specified

UniProt P61993

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4_PYRFU
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AE； PDBConstruct 1–180； UniProt 1–180 Author chain BE； PDBConstruct 1–180； UniProt 1–180

Small ribosomal subunit protein eS4

OrganismNot specified

UniProt Q8U011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4E_PYRFU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AF； PDBConstruct 1–243； UniProt 1–243 Author chain BF； PDBConstruct 1–243； UniProt 1–243

Small ribosomal subunit protein uS5

OrganismNot specified

UniProt Q8U017

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS5_PYRFU
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain AG； PDBConstruct 1–236； UniProt 1–236 Author chain BG； PDBConstruct 1–236； UniProt 1–236

Small ribosomal subunit protein eS6

OrganismNot specified

UniProt Q8U3H8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6E_PYRFU
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain AH； PDBConstruct 1–125； UniProt 1–125 Author chain BH； PDBConstruct 1–125； UniProt 1–125

Small ribosomal subunit protein uS7

OrganismNot specified

UniProt Q8U0M8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS7_PYRFU
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain AI； PDBConstruct 1–215； UniProt 1–215 Author chain BI； PDBConstruct 1–215； UniProt 1–215

Small ribosomal subunit protein uS8

OrganismNot specified

UniProt Q8U014

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8_PYRFU
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–130； UniProt 1–130 Author chain BJ； PDBConstruct 1–130； UniProt 1–130

Small ribosomal subunit protein eS8

OrganismNot specified

UniProt Q8U1Y5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8E_PYRFU
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain AK； PDBConstruct 1–127； UniProt 1–127 Author chain BK； PDBConstruct 1–127； UniProt 1–127

Small ribosomal subunit protein uS9

OrganismNot specified

UniProt Q8U0E7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_PYRFU
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain AL； PDBConstruct 1–135； UniProt 1–135 Author chain BL； PDBConstruct 1–135； UniProt 1–135

Small ribosomal subunit protein uS10

OrganismNot specified

UniProt P61885

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS10_PYRFU
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain AM； PDBConstruct 1–102； UniProt 1–102 Author chain BM； PDBConstruct 1–102； UniProt 1–102

Small ribosomal subunit protein uS11

OrganismNot specified

UniProt Q8U0E3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS11_PYRFU
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain AN； PDBConstruct 1–137； UniProt 1–137 Author chain BN； PDBConstruct 1–137； UniProt 1–137

Small ribosomal subunit protein uS12

OrganismNot specified

UniProt P61995

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_PYRFU
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain AO； PDBConstruct 1–147； UniProt 1–147 Author chain BO； PDBConstruct 1–147； UniProt 1–147

Small ribosomal subunit protein uS13

OrganismNot specified

UniProt Q8U0E2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS13_PYRFU
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain AP； PDBConstruct 1–148； UniProt 1–148 Author chain BP； PDBConstruct 1–148； UniProt 1–148

Small ribosomal subunit protein uS14

OrganismNot specified

UniProt Q8U013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS14Z_PYRFU
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–56； UniProt 1–56 Author chain BQ； PDBConstruct 1–56； UniProt 1–56

Small ribosomal subunit protein uS15

OrganismNot specified

UniProt Q8TZD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS15_PYRFU
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain AR； PDBConstruct 1–158； UniProt 1–158 Author chain BR； PDBConstruct 1–158； UniProt 1–158

Small ribosomal subunit protein uS17

OrganismNot specified

UniProt Q8U008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17_PYRFU
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain AS； PDBConstruct 1–113； UniProt 1–113 Author chain BS； PDBConstruct 1–113； UniProt 1–113

Small ribosomal subunit protein eS17

OrganismNot specified

UniProt Q8U0U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17E_PYRFU
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain AT； PDBConstruct 1–67； UniProt 1–67 Author chain BT； PDBConstruct 1–67； UniProt 1–67

Small ribosomal subunit protein uS19

OrganismNot specified

UniProt Q8U002

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19_PYRFU
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain AU； PDBConstruct 1–132； UniProt 1–132 Author chain BU； PDBConstruct 1–132； UniProt 1–132

Small ribosomal subunit protein eS19

OrganismNot specified

UniProt Q8U0T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U0T4_PYRFU
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain AV； PDBConstruct 1–150； UniProt 1–150 Author chain BV； PDBConstruct 1–150； UniProt 1–150

Small ribosomal subunit protein eS24

OrganismNot specified

UniProt Q8U442

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS24_PYRFU
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain AW； PDBConstruct 1–99； UniProt 1–99 Author chain BW； PDBConstruct 1–99； UniProt 1–99

Small ribosomal subunit protein eS31

OrganismNot specified

UniProt Q8U443

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 2 （Q8U474） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27A_PYRFU
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain AX； PDBConstruct 1–50； UniProt 1–50 Author chain BX； PDBConstruct 1–50； UniProt 1–50

Small ribosomal subunit protein eS27

OrganismNot specified

UniProt Q8U474

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS28 × 2 （Q8U159）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27_PYRFU
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain AY； PDBConstruct 1–63； UniProt 1–63 Author chain BY； PDBConstruct 1–63； UniProt 1–63

Small ribosomal subunit protein eS28

OrganismNot specified

UniProt Q8U159

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 60 RNA 2	RNA-binding protein × 2 （A0A5C0XRZ8） Small ribosomal subunit protein eS32 × 2 （Q8U232） Archaeal Ribosome Dimerizing Factor (aRDF) × 4 （Q8U3B0） Large ribosomal subunit protein eL8 × 2 （Q8U160） 16S rRNA × 2 Small ribosomal subunit protein uS2 × 2 （Q8U0F0） Small ribosomal subunit protein uS3 × 2 （Q8U004） Small ribosomal subunit protein eS1 × 2 （Q8TZE1） Small ribosomal subunit protein uS4 × 2 （P61993） Small ribosomal subunit protein eS4 × 2 （Q8U011） Small ribosomal subunit protein uS5 × 2 （Q8U017） Small ribosomal subunit protein eS6 × 2 （Q8U3H8） Small ribosomal subunit protein uS7 × 2 （Q8U0M8） Small ribosomal subunit protein uS8 × 2 （Q8U014） Small ribosomal subunit protein eS8 × 2 （Q8U1Y5） Small ribosomal subunit protein uS9 × 2 （Q8U0E7） Small ribosomal subunit protein uS10 × 2 （P61885） Small ribosomal subunit protein uS11 × 2 （Q8U0E3） Small ribosomal subunit protein uS12 × 2 （P61995） Small ribosomal subunit protein uS13 × 2 （Q8U0E2） Small ribosomal subunit protein uS14 × 2 （Q8U013） Small ribosomal subunit protein uS15 × 2 （Q8TZD9） Small ribosomal subunit protein uS17 × 2 （Q8U008） Small ribosomal subunit protein eS17 × 2 （Q8U0U1） Small ribosomal subunit protein uS19 × 2 （Q8U002） Small ribosomal subunit protein eS19 × 2 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS31 × 2 （Q8U443） Small ribosomal subunit protein eS27 × 2 （Q8U474）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS28_PYRFU
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain AZ； PDBConstruct 1–71； UniProt 1–71 Author chain BZ； PDBConstruct 1–71； UniProt 1–71

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9fnz
Deposition date deposition_date	2024-06-11
Structure title title	PF30S-PF30S dimer mediated by aRDF from P. furiosus (Structure II)
Keywords keywords	Pyrococcus furiosus, ribosomal subunit, dimerization, anti-association, ribosome-associated protein, TRANSLATION; TRANSLATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9fnz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9fnz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9fnz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	97.25 Å
Rg (electron density)	97.71 Å
Total Rg	97.66 Å
Atom count	130980
Residues	11293
Excluded volume	2108700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9fnz__assembly_1__model_1`	62-meric （62）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Description description	RNA-binding protein
Molecular weight formula_weight	6824.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,B1
Atom count atom_count	130980

MVEMKFEIPVCTSCGREITPREHATHFICPNCGEAVIWRCESCRVLAKPYKCPNCGWEGP

Entity 2 Entity 2 polymer

Description description	Small ribosomal subunit protein eS32
Molecular weight formula_weight	5023.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2,B2

MKRRPRKWKKKGRMRWKWIKKRIRRLKRQRKKERGLI

Entity 3 Entity 3 polymer

Description description	Archaeal Ribosome Dimerizing Factor (aRDF)
Molecular weight formula_weight	34792.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3,A4,B3,B4

MKVVGIKGSVSYLQALKYLKTKKVTKRLKEIEKLVDTLITLAPYAPEGSKIETIRKNYAKISFNKIKTVSRSKIGSPRIKSIMLLLWNFGLLDVKIIENSWYVRKTKLASLLEENFKDLSPSEKLKVYLLGGLLVDTPARFVYRCTLNGVEDYKGVKKAILGYLSDQRSNSLIIGLSNMLESIKFIEEAQAYSGKKEYIGLVDVAFYGLSGLYLDVKRESGKLTVKPNFRELRALYEIDKSVATGSDYGLSISKEILENLANTKRRKTIFSEEVQELLVNVIKENAISISQDLQNMYGIIHHHHHH

Source Source

Source organism organism	Pyrococcus furiosus
NCBI taxonomy ID ncbi_taxonomy_id	2261
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Large ribosomal subunit protein eL8
Molecular weight formula_weight	13414.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A5,B5

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK

Entity 5 Entity 5 polymer

Description description	16S rRNA
Molecular weight formula_weight	485455.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AA,BA

AUUCCGGUUGAUCCUGCCGGAGGCCACUGCUAUGGGGGUCCGACUAAGCCAUGCGAGUCAAGGGGGCGUCCCUUCUGGGACGCCACCGGCGGACGGCUCAGUAACACGUCGGUAACCUACCCUCGGGAGGGGGAUAACCCCGGGAAACUGGGGCUAAUCCCCCAUAGGCCUGGGGUACUGGAAGGUCCCCAGGCCGAAAGGGAGCCGUAAGGCCCGCCCGAGGAUGCGGCGGCGGCCGAUUAGGUAGUUGGUGGGGUAACGGCCCACCAAGCCGAAGAUCGGUACGGGCCGUGAGAGCGGGAGCCCGGAGAUGGACACUGAGACACGGGUCCAGGCCCUACGGGGCGCAGCAGGCGCGAAACCUCCGCAAUGCGGGAAACCGCGACGGGGGGACCCCCAGUGCCGUGCCUCUGGCACGGCUUUUCCGGAGUGUAAAAAGCUCCGGGAAUAAGGGCUGGGCAAGGCCGGUGGCAGCCGCCGCGGUAAUACCGGCGGCCCGAGUGGUGGCCACUAUUAUUGGGCCUAAAGCGGCCGUAGCCGGGCCCGUAAGUCCCUGGCGAAAUCCCACGGCUCAACCGUGGGGCUCGCUGGGGAUACUGCGGGCCUUGGGACCGGGAGAGGCCGGGGGUACCCCCGGGGUAGGGGUGAAAUCCUAUAAUCCCGGGGGGACCGCCAGUGGCGAAGGCGCCCGGCUGGAACGGGUCCGACGGUGAGCGCGGAAGGCCAGGGGAGCGAACCGGAUUAGAUACCCGGGUAGUCCUGGCUGUAAAGGAUGCGGGCUAGGUGUCGGGCGAGCUUCGAGCUCGCCCGGUGCCGUAGGGAAGCCGUUAAGCCCGCCGCCUGGGGAGUACGGCCGCAAGGCUGAAACUUAAAGGAAUUGGCGGGGGAGCACUACAAGGGGUGGAGCGUGCGGUUUAAUUGGAUUCAACGCCGGGAACCUCACCGGGGGCGACGGCAGGAUGAAGGCCAGGCUGAAGGUCUUGCCGGACGCGCCGAGAGGAGGUGCAUGGCCGCCGUCAGCUCGUACCGUGAGGCGUCCACUUAAGUGUGGUAACGAGCGAGACCCGCGCCCCCAGUUGCCAGUCCCUCCCGCUCGGGAGGAGGCACUCUGGGGGGACUGCCGGCGAUAAGCCGGAGGAAGGGGCGGGCGACGGUAGGUCAGUAUGCCCCGAAACCCCCGGGCUACACGCGCGCUACAAUGGGCGGGACAAUGGGACCCGACCUCGAAAGGGGAAGGGAAUCCCCUAAACCCGCCCUCAGUUCGGAUCGCGGGCUGCAACUCGCCCGCGUGAAGCUGGAAUCCCUAGUACCCGCGUGUCAUCAUCGCGCGGCGAAUACGUCCCUGCUCCUUGCACACACCGCCCGUCACUCCACCCGAGCGGAGUCCGGGUGAGGCCUGAUCUCCUUCGGGAGGUCAGGUCGAGCCCGGGCUCCGUGAGGGGGGAGAAGUCGUAACAAGGUAACCGUAGGGGAACCUACGGCUCGAUCACCUCCU

Entity 6 Entity 6 polymer

Description description	Small ribosomal subunit protein uS2
Molecular weight formula_weight	23039.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,BB

MADEYLVPLDQYLAAGVHIGTQQKTKDMKKFIYRVRQDGLYVLDVRKTDERLKVAGKFLAKFEPQSILAVSVRLYGQKPVKKFGEVTGARAIPGRFLPGTMTNPAVKNFFEPDVLIVTDPRADHQAMREAVEIGIPIVALVDTENLLSYVDLAIPTNNKGRKALALIYWILAREILYNRGEIQSREDFKIPVEEFEMKIVRR

Entity 7 Entity 7 polymer

Description description	Small ribosomal subunit protein uS3
Molecular weight formula_weight	23464.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,BC

MAIERYFIREAVREMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILEKQFGLENPQIEVEEIKNPYLNAKVQAVRLAQALERGIHFRRAAYAALRAIMNNGARGVEIRLSGKLTGERAKSIRFYQGYLAKVGNPAETLVSKGYAQALLKLGVIGVKVAIMPPGARLPDEIEIIEKPVEEEVVSNEAE

Entity 8 Entity 8 polymer

Description description	Small ribosomal subunit protein eS1
Molecular weight formula_weight	22984.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD,BD

MAAKRATTTRDKWKLKQWYIIYAPDFFGGVEVGLTPADDPEKVLNRVVEVTLKDVTGDFTKSHVKLYFQVYDVKGQNAYTKFKGMKLARSYIRSLVRRKTTRIDGIFNITTKDGYKLRVMAMAIAMRRIQTSQERAIRKIMQEIIYKKAEELNFKDFVLESVNGKIAAEIAKEAKKIYPLRKAEIRKIKVLEEPQVIA

Entity 9 Entity 9 polymer

Description description	Small ribosomal subunit protein uS4
Molecular weight formula_weight	21381.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE,BE

MGDPKRQRKKYETPPHPWIKERLDRERVLMDKYELKNKKELWKHETQLKNFRRRARRLLAARGKQAEIEREQLLARLKRLGLLPEDAVLDDVLSLTIEDILERRLQTIVYKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTITYARTSPFANPQHPERMMIEKAKQGGEA

Entity 10 Entity 10 polymer

Description description	Small ribosomal subunit protein eS4
Molecular weight formula_weight	28197.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF,BF

MARKGPKRHLKRLAAPTSWYIERKAYKWAVRPRPGPHNMRTSIPLLYIVRDYLGYAKTAREARKILNEGKFLVDGRVRKDYKFPVGIMDVVSIPETGEHYRVLPNRIGKLILHPISEDEAFIKPLRIRNKRMIKGARVQLNFHDGTNHIVSIAEKDNYFTSYTVLMKVPEREILEVLPFEKGAYVFVTQGKNVARKGRIVEIKRFPMGWPDVVTIEDEEGELFDTLKEYAFVVGTDKPKISLP

Entity 11 Entity 11 polymer

Description description	Small ribosomal subunit protein uS5
Molecular weight formula_weight	26590.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG,BG

MSQEWKEYAKRVLDEWEPKTKLGMMVKEGQITDIHEIFRRGYQIKEPEIIDVLLPEVNARENQEVLDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGHGKEVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFAVEGKEGSVRVRLIPGPRGLGLVIGDVGKKILRLAGVQDVWSQTFGETRTTVNFAKAVFNALYNTNRVAISPEMIERYGIVVGRAMPTTFTLE

Entity 12 Entity 12 polymer

Description description	Small ribosomal subunit protein eS6
Molecular weight formula_weight	14002.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH,BH

MATFKLVISDPKSGIAKQVEITGAETEKLIGKRIGDQIPAKELNINLNELFGKEFPEDVKLEIRGGTDKDGFPMRPDIHGPRRVRVLLSKGPGFRPKEKGERRKKTVRGNTISPEIVQVNVKLVY

Entity 13 Entity 13 polymer

Description description	Small ribosomal subunit protein uS7
Molecular weight formula_weight	24701.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI,BI

MAKPLNERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRHAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAYEVVKEAFKIIEQRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVDISPMRRLDVALRNIALGASAKCYRNKMSFAEALAEEIILAANKDPKSYAYSKKLEIERIAESSR

Entity 14 Entity 14 polymer

Description description	Small ribosomal subunit protein uS8
Molecular weight formula_weight	14684.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ,BJ

MTLLDPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQLLGRINKAGAIKPRFPVKVSEFEKWEKRFLPAFEFGILIVSTSQGVMSHKEAIEKGIGGRLIAYVY

Entity 15 Entity 15 polymer

Description description	Small ribosomal subunit protein eS8
Molecular weight formula_weight	14293.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK,BK

MAIWQGRSLKKPSGGRIVLARKKRKRELGREPSNTRVAEQDKRKIIRTYGGNRKVRLTAAAYANVFDKSGKGRKVRIIRVIENPANRQFARRNIITKGAIIETEIGKAKVTSRPGQDGVVNAILLEE

Entity 16 Entity 16 polymer

Description description	Small ribosomal subunit protein uS9
Molecular weight formula_weight	15317.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL,BL

MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSVDIDVKVEGGGFMGQAEAARMAIARALVEWTGDMSLKEKFMKYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

Entity 17 Entity 17 polymer

Description description	Small ribosomal subunit protein uS10
Molecular weight formula_weight	11769.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM,BM

MQKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGSATFDRWELRVHKRLIDIEADERAMRQIMRIRVPEDVTIEIELIS

Entity 18 Entity 18 polymer

Description description	Small ribosomal subunit protein uS11
Molecular weight formula_weight	14757.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN,BN

MSEEQVNIKKKEKWGIAHIYSSFNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV

Entity 19 Entity 19 polymer

Description description	Small ribosomal subunit protein uS12
Molecular weight formula_weight	16477.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO,BO

MPGKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR

Entity 20 Entity 20 polymer

Description description	Small ribosomal subunit protein uS13
Molecular weight formula_weight	16948.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP,BP

MANFRHIVRVAGVDLDGNKQLRWALTAIKGIGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILADPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSRKKK

Entity 21 Entity 21 polymer

Description description	Small ribosomal subunit protein uS14
Molecular weight formula_weight	6634.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ,BQ

MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIQGLMLCRHCFREVAPKLGFRKYE

Entity 22 Entity 22 polymer

Description description	Small ribosomal subunit protein uS15
Molecular weight formula_weight	18640.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR,BR

MARMHARKRGKSGSKRPPRTAPPIWVEYTVEEIENLVVKLRKEGYSTAMIGTILRDQYGIPSVKLFKDPDNPNRNLTITRILEKHGLAPEIPEDLMFLIRRAVNLRKHLEQHPKDLHSMRGLQLIESKIRRLVKYYKRKGKLPKNWRYDPETAKLLVR

Entity 23 Entity 23 polymer

Description description	Small ribosomal subunit protein uS17
Molecular weight formula_weight	13296.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS,BS

MMRDIGLRVQPPAEKCDDPKCPWHGNLKIHGRVFEGIVVSDKPRKTVTVERQYYFYLNKYERYELRRSKIHAHNPPCINAKVGDKVLIAETRPLSKTKHFVVVAVLERAEERR

Entity 24 Entity 24 polymer

Description description	Small ribosomal subunit protein eS17
Molecular weight formula_weight	7942.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT,BT

MGKIRQGFIKRVARELVNKYPNEFTTDFEHNKKKVQELTNVTSKKIRNRIAGYVTKLVRMKMEGKIL

Entity 25 Entity 25 polymer

Description description	Small ribosomal subunit protein uS19
Molecular weight formula_weight	15357.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU,BU

MARKEFRYRGYTLEQLMNMSLEELARLFPARQRRSLKRGLTPEQKKLLRKIRLAKKGKYKKPIRTHCRDMIILPEMVGLTIYVHNGKEFVPVEIKPEMIGHYLGEFAPTRKKVEHGAPGVGATRSSMFVAVK

Entity 26 Entity 26 polymer

Description description	Small ribosomal subunit protein eS19
Molecular weight formula_weight	17394.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV,BV

MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPEKFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY

Entity 27 Entity 27 polymer

Description description	Small ribosomal subunit protein eS24
Molecular weight formula_weight	11698.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AW,BW

MEIRIKEIKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYISKGYAKAYDSKERMLYIEPEYILIRDGLIEKKEGE

Entity 28 Entity 28 polymer

Description description	Small ribosomal subunit protein eS31
Molecular weight formula_weight	5865.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX,BX

MGQKWKLYEIKDGKVIRKNKFCPRCGPGVFMADHGDRWACGKCGYTEWKK

Entity 29 Entity 29 polymer

Description description	Small ribosomal subunit protein eS27
Molecular weight formula_weight	6888.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY,BY

MAKPIIPMPRSRFLRVKCIDCGNEQIVFSHPATKVRCLICGATLVEPTGGKGIVKAKILEVLE

Entity 30 Entity 30 polymer

Description description	Small ribosomal subunit protein eS28
Molecular weight formula_weight	8116.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ,BZ

MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNVRGPVRIGDILILRETEREAREIKSRR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	63890

PF30S-PF30S dimer mediated by aRDF from P. furiosus (Structure II)

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein eS32

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Archaeal Ribosome Dimerizing Factor (aRDF)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein eL8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein eS1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein eS4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer