9grx

NDH-PSI-LHCI supercomplex from S. oleracea

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic NDH subunit of lumenal location 1, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JJI5_SPIOL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–157； UniProt 77–233

Photosynthetic NDH subunit of subcomplex B 1, chloroplastic

OrganismNot specified

UniProt A0A9R0JDZ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JDZ5_SPIOL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–403； UniProt 56–458

Photosynthetic NDH subunit of subcomplex B 2, chloroplastic

OrganismNot specified

UniProt A0A9R0KAG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0KAG7_SPIOL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–372； UniProt 1–372

Photosynthetic NDH subunit of subcomplex B 3, chloroplastic

OrganismNot specified

UniProt A0A9R0J911

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0J911_SPIOL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–139； UniProt 69–207

Photosynthetic NDH subunit of subcomplex B 4, chloroplastic

OrganismNot specified

UniProt A0A9R0J426

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0J426_SPIOL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4； PDBConstruct 1–93； UniProt 68–160

Photosynthetic NDH subunit of subcomplex B 5, chloroplastic

OrganismNot specified

UniProt A0A9R0JS52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JS52_SPIOL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 5； PDBConstruct 1–154； UniProt 62–215

Photosynthetic NDH subunit of lumenal location 2, chloroplastic

OrganismNot specified

UniProt A0A9R0I5E4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0I5E4_SPIOL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6； PDBConstruct 1–125； UniProt 74–198

Photosynthetic NDH subunit of lumenal location 3, chloroplastic

OrganismNot specified

UniProt A0A9R0JBH0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JBH0_SPIOL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 7； PDBConstruct 1–144； UniProt 78–221

peptidylprolyl isomerase

OrganismNot specified

UniProt A0A9R0IC28

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0IC28_SPIOL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 8； PDBConstruct 1–143； UniProt 89–231

Peptidyl-prolyl cis-trans isomerase

OrganismNot specified

UniProt A0A9R0IB03

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0IB03_SPIOL
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 9； PDBConstruct 1–174； UniProt 80–253

NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic

OrganismNot specified

UniProt Q9M3I6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1C_SPIOL
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain A； PDBConstruct 1–350； UniProt 16–365

NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic

OrganismNot specified

UniProt P0CD52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2C1_SPIOL
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain B； PDBConstruct 1–488； UniProt 20–507

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

OrganismNot specified

UniProt Q9M3L9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3C_SPIOL
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain C； PDBConstruct 1–115； UniProt 5–119

NAD(P)H-quinone oxidoreductase chain 4, chloroplastic

OrganismNot specified

UniProt Q9M3J0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4C_SPIOL
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain D； PDBConstruct 1–498； UniProt 3–500

NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

OrganismNot specified

UniProt Q9M3I9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LC_SPIOL
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain E； PDBConstruct 1–100； UniProt 1–100

NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic

OrganismNot specified

UniProt Q9M3J4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5C_SPIOL
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain F； PDBConstruct 1–742； UniProt 1–742

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

OrganismNot specified

UniProt Q9M3I8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6C_SPIOL
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain G； PDBConstruct 1–176； UniProt 1–176

NAD(P)H-quinone oxidoreductase subunit H, chloroplastic

OrganismNot specified

UniProt Q9M3I5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHH_SPIOL
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain H； PDBConstruct 1–389； UniProt 5–393

NAD(P)H-quinone oxidoreductase subunit I, chloroplastic

OrganismNot specified

UniProt Q9M3I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHI_SPIOL
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain I； PDBConstruct 1–163； UniProt 4–166

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

OrganismNot specified

UniProt Q9M3M1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHJ_SPIOL
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain J； PDBConstruct 1–158； UniProt 1–158

NAD(P)H-quinone oxidoreductase subunit K, chloroplastic

OrganismNot specified

UniProt Q9M3M0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHK_SPIOL
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain K； PDBConstruct 1–202； UniProt 1–202

NAD(P)H-quinone oxidoreductase subunit L, chloroplastic

OrganismNot specified

UniProt A0A9R0JHB5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JHB5_SPIOL
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain L； PDBConstruct 1–109； UniProt 73–181

NAD(P)H-quinone oxidoreductase subunit M, chloroplastic

OrganismNot specified

UniProt A0A9R0JNY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JNY9_SPIOL
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain M； PDBConstruct 1–141； UniProt 63–203

NAD(P)H-quinone oxidoreductase subunit N, chloroplastic

OrganismNot specified

UniProt A0A9R0J7P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0J7P2_SPIOL
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain N； PDBConstruct 1–165； UniProt 64–228

NAD(P)H-quinone oxidoreductase subunit O, chloroplastic

OrganismNot specified

UniProt A0A9R0K504

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0K504_SPIOL
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain O； PDBConstruct 1–95； UniProt 57–151

NAD(P)H-quinone oxidoreductase subunit U, chloroplastic

OrganismNot specified

UniProt A0A9R0K267

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0K267_SPIOL
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain U； PDBConstruct 1–240； UniProt 1–240

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

UniProt P06511

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_SPIOL
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain a； PDBConstruct 1–742； UniProt 9–750

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P06512

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_SPIOL
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain b； PDBConstruct 1–733； UniProt 2–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P10098

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_SPIOL
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain c； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt P12353

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SPIOL
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain d； PDBConstruct 1–143； UniProt 70–212

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P12354

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_SPIOL
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain e； PDBConstruct 1–68； UniProt 58–125

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P12355

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_SPIOL
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain f； PDBConstruct 1–153； UniProt 78–230

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt P12357

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_SPIOL
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain g； PDBConstruct 1–97； UniProt 71–167

Photosystem I reaction center subunit VI, chloroplastic

OrganismNot specified

UniProt P22179

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAH_SPIOL
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain h； PDBConstruct 1–95； UniProt 50–144

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17228

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_SPIOL
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain i； PDBConstruct 1–31； UniProt 1–31

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt A0A6B9Q8A1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6B9Q8A1_9ERIC
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain j； PDBConstruct 1–42； UniProt 1–42

PSI-K

OrganismNot specified

UniProt A0A9R0IBB5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0IBB5_SPIOL
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain k； PDBConstruct 1–130； UniProt 1–130

Photosystem I reaction center subunit XI, chloroplastic

OrganismNot specified

UniProt Q41385

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_SPIOL
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain l； PDBConstruct 1–160； UniProt 57–216

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0JIF6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JIF6_SPIOL
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain w； PDBConstruct 1–215； UniProt 43–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0J335

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0J335_SPIOL
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain x； PDBConstruct 1–198； UniProt 53–250

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0IPK6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J8B1） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0IPK6_SPIOL
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain y； PDBConstruct 1–221； UniProt 54–274

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0J8B1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （A0A9R0JJI5） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （A0A9R0JDZ5） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （A0A9R0KAG7） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （A0A9R0J911） Photosynthetic NDH subunit of subcomplex B 4, chloroplastic × 1 （A0A9R0J426） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （A0A9R0JS52） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （A0A9R0I5E4） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （A0A9R0JBH0） peptidylprolyl isomerase × 1 （A0A9R0IC28） Peptidyl-prolyl cis-trans isomerase × 1 （A0A9R0IB03） NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q9M3I6） NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic × 1 （P0CD52） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （Q9M3L9） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （Q9M3J0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （Q9M3I9） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （Q9M3J4） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q9M3I8） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （Q9M3I5） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （Q9M3I7） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q9M3M1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （Q9M3M0） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （A0A9R0JHB5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （A0A9R0JNY9） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A9R0J7P2） NAD(P)H-quinone oxidoreductase subunit O, chloroplastic × 1 （A0A9R0K504） NAD(P)H-quinone oxidoreductase subunit U, chloroplastic × 1 （A0A9R0K267） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P06511） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P06512） Photosystem I iron-sulfur center × 1 （P10098） Photosystem I reaction center subunit II, chloroplastic × 1 （P12353） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12354） Photosystem I reaction center subunit III, chloroplastic × 1 （P12355） Photosystem I reaction center subunit V, chloroplastic × 1 （P12357） Photosystem I reaction center subunit VI, chloroplastic × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17228） Photosystem I reaction center subunit IX × 1 （A0A6B9Q8A1） PSI-K × 1 （A0A9R0IBB5） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q41385） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0JIF6） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0J335） Chlorophyll a-b binding protein, chloroplastic × 1 （A0A9R0IPK6） BETA-CAROTENE × 29 (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 24 4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 IRON/SULFUR CLUSTER × 6 CHLOROPHYLL A × 144 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 3 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 CHLOROPHYLL B × 9 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0J8B1_SPIOL
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain z； PDBConstruct 1–193； UniProt 48–240

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9grx
Deposition date deposition_date	2024-09-13
Structure title title	NDH-PSI-LHCI supercomplex from S. oleracea
Keywords keywords	NDH, PSI, Supercomplex, photosynthesis, electron transport chain, lipids, proton translocation, plastoquinone, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9grx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9grx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9grx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	98.44 Å
Rg (electron density)	99.98 Å
Total Rg	99.85 Å
Atom count	83864
Residues	9086
Excluded volume	1539600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9grx__assembly_1__model_1`	42-meric （42）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (55)

Entity 1 Entity 1 polymer

Description description	Photosynthetic NDH subunit of lumenal location 1, chloroplastic
Molecular weight formula_weight	18606.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0
Atom count atom_count	83864

KETPERYTAFVDKADGYSYVYPSDWREFDFRAHDSAFKDRYLQLQNVRLSFIPTDKNDVHDLGPMEDVIQTLVKNILAAPNQMTDIREIQERSVDGKNYWTFEYNLTSPNFSVTHFTTLAIANGRYYTLTVSANERRWKRYRNKLKVVADSFKVFEI

Entity 2 Entity 2 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 1, chloroplastic
Molecular weight formula_weight	44622.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

NPWLDLFYDGEDEPETEYGSMFSDGKQDEDPYPRDNPENPYGFLKFPQGYAVEMASLGSKVRGDVRRCCCVVSGGVYDNLLFFPAIQLIKDRYPGVQIDIITSARGKQTYEMNKNVRWATVYDLDDNFPDPAEYTDMLGLLKNRYYDMVLSTKLAGLGHAAFLFMTTARDRVSYVYPNVNAAGAGLLLSETFTPDSMNLSEGGYNMYHQMIEWLGRPVKDIPQHLASPLKVSISRKLKEAVEAKYKEAGAEKGKYVVIHGIKCDSKASMQSEGDTDSLLPIEIWAEISQAIRGVTPIFVIPHEKLREDVEEIVGEETSIVFITTPGQLAALINDSVGVIATNTAAIQLALAREKPSIALFCSEEKGKCFVPDAEGKKCTVIASKTGNLADIDVAVVKDTLKVF

Entity 3 Entity 3 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 2, chloroplastic
Molecular weight formula_weight	40259.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MASLLPFSLLKPTTICKASSTAAPPAALVESLNDQFARKGINFLESTDTSTNISSPIVELSVRNGSSLKLQLSNAHVTSYKPKVYWKDDGFEEVLYTLPLSKGGIGLVLNDVTQPVTTTKKPDPFRRSEPAAAAAAKGSLLAGAEWSVRDVDSDSFDAVQVELSCTSGSLEITYVVSLYPESMASAVLVKNNGNKAIGLTSAILSHIQFKKRSGSGIQGLQGCSYCSHPPLSSPFEIVSPAEAMKAEDPGMFSFSSESPSKLGEWTTQEVPITILKNKLSRVYTAPPSERSKKFYRTTPSKYETVDQGRELVFRVIRMGYDDILVSSPGSLSEKYGRDYFICTGPASILVPVTVNPGEEWRGAQVIEHDNLT

Entity 4 Entity 4 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 3, chloroplastic
Molecular weight formula_weight	15614.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

EEEELEPPYVGFAFVSSVLLPDGTPDMHLRSATGGQKLRDIMLDNDIDLYGPYARPLLNCAGGGTCASCMVEVIEGKELLNPRTEKEKEHLKKKPKNWRLACQITVGTPESRGMVVIQQLPEWKAHEWKYEKDGPIVSE

Entity 5 Entity 5 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 4, chloroplastic
Molecular weight formula_weight	10763.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAVLVEHVEGQRDLITHKSIWHLSDAAIKNVYLFYMMFTCWGCCVFGAAKDPYYDSEQYRGDGGDGTGHWVYEKQEDIEEAGRAALWREELIE

Entity 6 Entity 6 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 5, chloroplastic
Molecular weight formula_weight	17772.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

GLTDIEPDLNEDPRDRWATNGVAPEDFVYGKYDEHHTFYESSEKGSFWGAVAEEYNSMDPPTGFQGLISWLFLPAVAAGMYFNVPGDYLFIGAGLFVIIFCIIEMDKPDQPHNFEPQIYNMERGARDKLIADYNTMDIWDFNEKYGDLWDFTLK

Entity 7 Entity 7 polymer

Description description	Photosynthetic NDH subunit of lumenal location 2, chloroplastic
Molecular weight formula_weight	14876.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

EFKWGTRSFIWERFFEPGLSPEDAVSRIKNTAEGLHSLRHMLETMSWRYVIFYIRLKQAYLKQDMKSAMIMVPEGRRDDYSNAANELVDNMAEFDYYVRTPKVYESYVSYEKTLKSIDNLLGFLA

Entity 8 Entity 8 polymer

Description description	Photosynthetic NDH subunit of lumenal location 3, chloroplastic
Molecular weight formula_weight	16452.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

QLWLDGPLPGLRPAENKIGNEETGTRTFLKKGIYMANIGTKGSALRLRKYAFDLLAMEDLIGQDTLNYVRRYLRFKGTFMYYDFDKVISAAPVADKPPLTNLANRLFDNFEKLQEAVKLKDVPLTRSCYDDTAVTLQEVMNRMA

Entity 9 Entity 9 polymer

Description description	peptidylprolyl isomerase
Molecular weight formula_weight	15352.5 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

LRVEYYATTAEPSCELNLVRSGLGYCDLVVGSGVPAPYNTLINVHYTARFSDETVFDSSYKRGRPLTMRIGVGKVIKGLDQGIFGGDGVPPMQVGGKRKLRIPPHLGYGPEPAGCFSGDCNVPANATLLYDVTFMGVYSGNRA

Entity 10 Entity 10 polymer

Description description	Peptidyl-prolyl cis-trans isomerase
Molecular weight formula_weight	18900.4 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

PLQSKVTNKVYFDISIGNPVGKLVGRVVIGLFGDDVPQTAENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLTHTGPGTVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVLEGMDIVKLIESSETDRGDRPKKRVVISECGELPA

Entity 11 Entity 11 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic
Molecular weight formula_weight	38985.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

FSRLEFLKEVYETIWMLFPILILVLGITIGVLVIVWLEREISASIQQRIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTYLFSIGPSIAVISILLGYLIIPFGSRLVLADLSIGVFLWIAVSSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVLSISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFIISSLAECERLPFDLPEAEEELVAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGWNLSIPYIFISEFFEINKIDGVFGTTIGIFITLAKTFLFLFIPITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQLFSL

Entity 12 Entity 12 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic
Molecular weight formula_weight	54026.1 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

KAFHLLLFDGSLIFPECILIFGLILLLMIDSTSDQKDIPWLYFISSTSLVMSITALLFRWREEPMISFSGNFQTNNFNEIFQFLILLCSTLCIPLSVEYIECTEMALTEFLLFILTATLGGMFLCGANDLITIFVAPECFSLCSYLLSGYTKKDVRSNEATTKYLLMGGASSSILVHGFSWLYGSSGGEIELQEIVNGLINTQMYNSPGISIALIFITVGIGFKLSPAPSHQWTPDVYEGSPTPVVAFLSVTSKVAASASATRIFDIPFYFSSNEWHLLLEILAILSMILGNLIAITQTSMKRMLAYSSIGQIGYVIIGIIVGDSNDGYASMITYMLFYISMNLGTFACIVLFGLRTGTDNIRDYAGLYTKDPFLALSLALCLLSLGGLPPLAGFFGKIYLFWCGWQAGLYFLVLIGLLTSVLSIYYYLKIIKLLMTGRNQEITPHVRNYRRSPLRSKNSIEFSMIVCVIASTIPGISMNPIITIAQD

Entity 13 Entity 13 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
Molecular weight formula_weight	13270.7 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

YEYDIFWAFLIISSVIPILAFLFSGILAPISKGPEKLSSYESGIEPMGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDILGVSVFIEALIFVLILIVGLVYAWRKGALEW

Entity 14 Entity 14 polymer

Description description	NAD(P)H-quinone oxidoreductase chain 4, chloroplastic
Molecular weight formula_weight	55980.2 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

SFPWLTTIVVLPIFAGSLIFLFPHRGNKVIRWYTICISMIELLLMTYVFFYHFQPDDPLIQLVEDYKWINFFDFHWRLGIDGLSIGPILLTGFITTLATLAAWPVTRNSQLFHFLMLAMYSAQIGLFSSRDLLLFFIMWELELIPVYLLLSMWGGKKRLYSATKFILYTAGGSIFLLMGVLGVGLYGSNEPTLNLETLVNQSYPVALEIIFYIGFFIAFAVKLPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLMIIGTMQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGISSITDTGLNGAILQIISHGFIGAALFFLAGTSYDRIRLVYLDEMGGIAIPMPKIFTLFSSFSMASLALPGMSGFIAELIVFFGLITSQKYLLIPKLLITFGMAIGMILTPIYLLSMSRQMFYGYKLFNISNSSFFDSGPRELFVSTSIFLPVIGIGVYPDLVLSLSVEKVEAILSNYFYR

Entity 15 Entity 15 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic
Molecular weight formula_weight	11085.0 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MILEHVLVLSAFLFSIGIYGLVTSRNLVRALMCLELILNAVNLNFVTFSDFFDSRQLKGNIFSIFVIAIAAAEAAIGPAIVSSIYRNRKSIRINQSNLLN

Entity 16 Entity 16 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic
Molecular weight formula_weight	84590.1 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MEHIYQYAWIIPFLPLPVPLLIGAGLLFFPTATKNLRRIWAFSSISLLSIVMIFSMKLAIQQINSNSIYQYLWSWTINNDFSLEFGYLMDPLTSIMSMLITTVAILVLIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFGLLLGILGLYWITGSFEFRDLFEIFNNLIKNNEVNSLFCILCAFLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVVIPYIMYVISFIGIITVLLGATLALAQKDIKRSLAYYTMSQLGYMMLALGMGSYRTALFHLITHAYSKALLFLASGSLIHSMGTIVGYSPDKSQNMVLMGGLTKHVPITKTSFLIGTLSLCGIPPLACFWSKDEILNDSWVYSPIFAIIAYFTAGLTAFYMFRIYLLTFEGHLNFFCKNYSGKKSSSFYSISLWGKKELKTINQKISLLNLLTMNNKERASFFSKKPYEINVKLTKLLRSFITITYFENKNISLYPYESDNTMLFPLIILIMFTLFVGFIGIPFNQEGMDLDILTKWLTPSINLLHSNSENFVDWYEFVINAIFSISIAFFGIFIAFFFYKPIYSSLKNFDLINSFDKRGQKRILGDNIITIIYNWSANRGYIDAFYSTFLIKGIRSLSELVSFFDRRIIDGIPNGFGVTSFFVGEGIKYVGGGRISSYLFWYLLYVSIFLFIFTFT

Entity 17 Entity 17 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic
Molecular weight formula_weight	19193.7 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDLPGPIHDFLLVFLGSGLILGALGVVLFTNPIFSAFSLGLVLVCISLFYILANSHFVASAQLLIYVGAINVLIIFSVMFMSGPEYDKKFQLWTVGDGVTSLVCISLFVSLISTILNTSWYGIIWTTKSNQILEQDLINASQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

Entity 18 Entity 18 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic
Molecular weight formula_weight	45172.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

TTRKDLMIVNMGPHHPSMHGVLRLIVTLDGEDVIDCEPIVGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITVNGPEQLGNIQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYILRERELIYDLFEAATGMRMMHNYFRIGGVAADLPYGWIDKCLDFCDYFLIGLTEYQKLITRNPIFLERVENVGIIGGEEAINWGLSGPMLRASGIQWDLRKVDHYECYDEFDWEVQWQKEGDSLARYLIRIGEMAESVKIIQQALEGIPGGPYENLEIRRFNRIKYPEWNDFEYRFISKKPSPAFELSKQELYVRVEAPKGELGIFLIGDQSVFPWRWKIRPPGFINLQILPQLVKKMKLADIMTILGSIDIIMGEVDR

Entity 19 Entity 19 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit I, chloroplastic
Molecular weight formula_weight	19004.9 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MVTGFINYGQQTIRAARYIGQSFMITLSHANRLPVTIQYPYEKLITSERFRGRIHFEFDKCIACEVCVRACPIDLPVVDWKLETDIRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQIALGRLPISITDDYTIRTILNSPQTKE

Entity 20 Entity 20 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit J, chloroplastic
Molecular weight formula_weight	18687.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRRNPRIPSVFWVWKSADFQERESYDMFGISYDNHPRLKRILMPESWIGWPLRKDYIVPNFYEIQDAY

Entity 21 Entity 21 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit K, chloroplastic
Molecular weight formula_weight	22789.4 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNSIEFPLLDQIAQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRASPRQADLILTAGTVTMKMAPSLLRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKISREIYEDRIKSQPKNRCFTINHKFRVGRSIHTGNYDQALLYKYKS

Entity 22 Entity 22 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit L, chloroplastic
Molecular weight formula_weight	13194.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

AVTGVNNQEDLIWVLLKAGVVGFCYFLIMPPIIMNWLRIRWYRRNLLEMYFQFMFVFIFFPGILVWAPFLNFRKFPRDPTMKYPWSKPENPSEVKGGFLKYPWATIEDY

Entity 23 Entity 23 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit M, chloroplastic
Molecular weight formula_weight	16702.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

EMKEVLKRATPIEAQVNVKSRNLEREYGGQWLSSVTRHVRIYAAYIDPVTCAMDQTQMDKLTLMIDPTDEFLWNDETLNKVYVYFEELVDHYEGAPLTEYTLRLIGSDIEHYIRKMLYEGEIKYNMNSRVLNFSMGKPRMK

Entity 24 Entity 24 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit N, chloroplastic
Molecular weight formula_weight	18727.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

IGIRDFIGGDLVKFDLGTWLSDVEEHKAIAMYSPHEGGYEGRYLNRLRYQGYHFLDVSARGLGDPETTLTKVHPVCPPHVGKQPIARWWFPPEVDYRLEALPSDAKGLVVWVIEAKVLSKAELQFLAMLPSLRPKVRVIAECGNWRKVMWKPLKEIAGLVPLQEA

Entity 25 Entity 25 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit O, chloroplastic
Molecular weight formula_weight	11127.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

PPPKKPPKPVYSMKKGQIVRVEREKYLDSVNYLSVGHPKYYKGLDYIYEDRGEVLDLRFFETGEYALVSWVGIPTSPAWLPTDMLIKSDKLNYER

Entity 26 Entity 26 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit U, chloroplastic
Molecular weight formula_weight	27127.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAVSSTCMPHRELMPTLVKSTNTSTLFWLNNNTNNNVNVNVITTNNYVTLTRKAPCSRFLARSTEDASEMTATSTDQSWEGEGENSPMEMPKGPPSIISALNVEKALRGIGITDVDHYARLGLRRGCTYDQVGAAYEIQVKELSSQGMDEEQFNKERDLLKESYNILSSEQERRLYDWSLARNSAPERYMWPFEADITQTPRWGTPPPQEPEDVGPTTAVGYFLLAWFVFSFILSIALNR

Entity 27 Entity 27 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82145.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

EVKILVDRDPVKTSFEAWAKPGHFSRTIAKGPETTTWIWNLHADAHDFDSHTSDLEEISRKIFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLNAGVDPKEIPLPHELILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPVTGGLWLTDTAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLALNLAMLGSLTIVVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPSATAPGATASTSLTWGGSDLVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGSISDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 28 Entity 28 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82377.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

ALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFESWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSVISLLGGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPGSRGEYVRWNNFLDVLPHPQGLGPLFTGQWNLYAQNPDSSSHLFGTSQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAFVFLVAGHMYRTNFGIGHSMKDLLEAHIPPGGRLGRGHKGLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTSGPAFNAGRSIWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG

Entity 29 Entity 29 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	9035.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLGY

Entity 30 Entity 30 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	16053.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

GFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL

Entity 31 Entity 31 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	7736.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

KPPPIGPKRGSKVRIMRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEVA

Entity 32 Entity 32 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17151.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNN

Entity 33 Entity 33 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	10719.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

LSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF

Entity 34 Entity 34 polymer

Description description	Photosystem I reaction center subunit VI, chloroplastic
Molecular weight formula_weight	10391.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

KYGDKSVYFDLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLPITRGPQQPPKLGPRGKI

Entity 35 Entity 35 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3458.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MNFPSIFVPLVGLVFPAIAMASLFLYVQKNK

Entity 36 Entity 36 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4845.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF

Entity 37 Entity 37 polymer

Description description	PSI-K
Molecular weight formula_weight	13229.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MASVMMTSLPQFTGLRSQQASFPVKSLSAGLPLRGKGKGALGARCGDFIGSSTNLIMVTSTTLMLFAGRFGLAPSANRKSTAGLRLEVRDSGLQTGDPAGFTLADTLACGSFGHIIGVGVVLGLKNIGAI

Entity 38 Entity 38 polymer

Description description	Photosystem I reaction center subunit XI, chloroplastic
Molecular weight formula_weight	16988.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

QVIQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSMCLTMYGIASFKEGEPSIAPALTLTGRKKQPDQLQSADGWAKFTGGFFFGGVSGVTWACFLMYVLDLPYYFK

Entity 39 Entity 39 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23947.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

GGISSVCEPLPPDRPLWFPGSTPPQWLDGSLPGDFGFDPLGLGSDPETLRWFAQAELMHSRWAMLAVAGILIPEWLESIGLMENFNWYDAGSREYFADPTTLFVVQLALMGWVEGRRWADYVNPGCVDIEPKLPNRKNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGLCFQAVYTGEGPLENLSRHVADPGHCNIFSA

Entity 40 Entity 40 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	22135.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

KKGEWLPGLASPGYLTGSLPGDNGFDPLALAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIIDVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQYSLPPNECGYPGGIFNPLNFAPTTEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFDNLQQHLSDPWHNTIIQTF

Entity 41 Entity 41 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	24168.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

RPLWFASKQSLSYLDGSLPGDFGFDPLGLSDPEGTGGFIEPRWLAYGEIINGRYAMLGAVGAIAPEILGKAGLIPQETALPWFQTGVIPPAGTYNYWADPFTLFVFEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFAGSGEPAYPGGPIFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHLADPVNNNILTSLKFH

Entity 42 Entity 42 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	21184.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

EWMPGQPRPAHLDGSAPGDFGFDPLGLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGNLPTILAIEFLAIAFVEHQRSMEKDSEKKKYPGGAFDPLGYSKDPKKFEELKLKEIKNGRLALLAFVGFCIQQSAYPGTGPLENLATHLADPWHNNIGDIVIP

Entity 43 Entity 43 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	29

Entity 44 Entity 44 non-polymer

Description description	(1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE
Molecular weight formula_weight	751.0 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 45 Entity 45 non-polymer

Description description	4-trans-(4-trans-Propylcyclohexyl)-cyclohexyl alpha-maltoside
Molecular weight formula_weight	548.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 46 Entity 46 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 47 Entity 47 non-polymer

Description description	5-[(2E,6E,10E,14E,18E,22E)-3,7,11,15,19,23,27-HEPTAMETHYLOCTACOSA-2,6,10,14,18,22,26-HEPTAENYL]-2,3-DIMETHYLBENZO-1,4-QUINONE
Molecular weight formula_weight	613.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 48 Entity 48 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 49 Entity 49 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 50 Entity 50 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	144

Entity 51 Entity 51 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 52 Entity 52 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 53 Entity 53 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 54 Entity 54 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 55 Entity 55 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	8

▶

Resolution resolution	3.19 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	38385

NDH-PSI-LHCI supercomplex from S. oleracea

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic NDH subunit of lumenal location 1, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 1, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 4, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 5, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of lumenal location 2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of lumenal location 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

peptidylprolyl isomerase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Peptidyl-prolyl cis-trans isomerase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer