2o01

The Structure of a plant photosystem I supercomplex at 3.4 Angstrom resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–754； UniProt 5–758

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P05311

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–732； UniProt 2–733

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P10793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 1–80

Photosystem I reaction center subunit II, chloroplast

OrganismNot specified

UniProt P12353

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SPIOL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–138； UniProt 75–212

Photosystem I reaction center subunit IV A, chloroplast

OrganismNot specified

UniProt Q9S831

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE1_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–62； UniProt 81–142

Photosystem I reaction center subunit III, chloroplast

OrganismNot specified

UniProt P12355

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_SPIOL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–154； UniProt 78–231

Photosystem I reaction center subunit V, chloroplast

OrganismNot specified

UniProt P12357

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_SPIOL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–95； UniProt 73–167

Photosystem I reaction center subunit VI, chloroplast

OrganismNot specified

UniProt P22179

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAH_SPIOL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–75； UniProt 70–144

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–30； UniProt 1–30

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P17230

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_SPIOL
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

Photosystem I reaction center subunit XI, chloroplast

OrganismNot specified

UniProt Q41385

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_SPIOL
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–164； UniProt 53–216

Photosystem I-N subunit

OrganismNot specified

UniProt Q84U30

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84U30_PHAVU
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain N； PDBConstruct 1–85； UniProt 86–170

AT3g54890

OrganismNot specified

UniProt Q01667

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q01667_ARATH
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 1； PDBConstruct 1–187； UniProt 49–235

Type II chlorophyll a/b binding protein from photosystem I

OrganismNot specified

UniProt Q41038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 2； PDBConstruct 1–186； UniProt 74–259

PSI type III chlorophyll a/b-binding protein

OrganismNot specified

UniProt Q9SY97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI light-harvesting antenna chlorophyll a/b-binding protein × 1 （Q9SQL2） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9SY97_ARATH
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 3； PDBConstruct 1–165； UniProt 95–259

PSI light-harvesting antenna chlorophyll a/b-binding protein

OrganismNot specified

UniProt Q9SQL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplast × 1 （P12353） Photosystem I reaction center subunit IV A, chloroplast × 1 （Q9S831） Photosystem I reaction center subunit III, chloroplast × 1 （P12355） Photosystem I reaction center subunit V, chloroplast × 1 （P12357） Photosystem I reaction center subunit VI, chloroplast × 1 （P22179） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （P17230） Photosystem I reaction center subunit psaK, chloroplast × 1 Photosystem I reaction center subunit XI, chloroplast × 1 （Q41385） Photosystem I-N subunit × 1 （Q84U30） AT3g54890 × 1 （Q01667） Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） PSI type III chlorophyll a/b-binding protein × 1 （Q9SY97） CHLOROPHYLL A × 168 PHYLLOQUINONE × 2 BETA-CAROTENE × 5 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9SQL2_PEA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 4； PDBConstruct 1–165； UniProt 85–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2o01
Deposition date deposition_date	2006-11-27
Structure title title	The Structure of a plant photosystem I supercomplex at 3.4 Angstrom resolution
Keywords keywords	Membranal Super Complex, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2o01__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2o01__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2o01__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.69 Å
Rg (electron density)	50.53 Å
Total Rg	50.58 Å
Atom count	29846
Residues	3043
Excluded volume	533890 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2o01__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83669.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	29846

SPEPKVQILADPEVKILVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAGLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAQHMYSMPPYPYLATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATASTSLTWGGGDLVAVGNKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTINDQGVVTHITAGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82226.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ALRIPRFSQGIAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPFHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNNAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSAISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPSSSNHLFGTTQGAGTAILTILGGFHPQTQSLWLTDVAHHHLAIAFLFLIGGLMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGPIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDIPLSSTNGPALNAGRNIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDDFYLAVFWMLNTIGWVTFYWHWKHITLWRGNVSQFNESSTYLMGWLRDYLWLNSSQLINGITPLVCNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKF

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8860.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplast
Molecular weight formula_weight	15553.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

ELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV A, chloroplast
Molecular weight formula_weight	7127.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

PKRGSKVKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEVA

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplast
Molecular weight formula_weight	17299.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplast
Molecular weight formula_weight	10518.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

PSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VI, chloroplast
Molecular weight formula_weight	8143.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

WDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLPITRGPQQPPKLGPRGKI

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3270.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MINLPSLFVPLVGLLFPAVAMASLFLHVEK

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4845.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplast
Molecular weight formula_weight	3252.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit XI, chloroplast
Molecular weight formula_weight	17479.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

KPTYQVIQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSMCLTMYGIASFKEGEPSIAPALTLTGRKKQPDQLQSADGWAKFTGGFFFGGVSGVTWACFLMYVLDLPYYFK

Entity 13 Entity 13 polymer

Description description	Photosystem I-N subunit
Molecular weight formula_weight	9767.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

GVIEEYLEKSKTNKELNDKKRLATTGANFARAYTVEFGSCKFPENFTGCQDLAKQKKVPFLSDDLDLECEGKDKYKCGSNVFWKW

Entity 14 Entity 14 polymer

Description description	AT3g54890
Molecular weight formula_weight	20415.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MPGEPRPAYLDGSAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGD

Entity 15 Entity 15 polymer

Description description	Type II chlorophyll a/b binding protein from photosystem I
Molecular weight formula_weight	20580.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

PEWLDGSLPGDFGFDPLGLSSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGH

Entity 16 Entity 16 polymer

Description description	PSI type III chlorophyll a/b-binding protein
Molecular weight formula_weight	17929.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

WLAYGEIINGRFAMLGAAGAIAPEILGKAGLIPAETALPWFQTGVIPPAGTYTYWADNYTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGLAGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHLA

Entity 17 Entity 17 polymer

Description description	PSI light-harvesting antenna chlorophyll a/b-binding protein
Molecular weight formula_weight	18561.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

PENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	168

Entity 19 Entity 19 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 20 Entity 20 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 21 Entity 21 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 15 domains

CATH v4.4 (15 domains)

Domain ID domain_id	2o01100
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	2o01200
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	2o01300
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	2o01401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	2o01A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	2o01B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	2o01C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2o01D01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	2o01E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	2o01F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	2o01G01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — Chlorophyll a-b binding protein like

Domain ID domain_id	2o01H01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	220 —

Domain ID domain_id	2o01J01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	2o01L01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	2o01N01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	740 — Single helix bin

▶

Unit-cell length a length_a	120.054 Å
Unit-cell length b length_b	188.784 Å
Unit-cell length c length_c	127.518 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.19 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.3510
R_work r_work	0.3480
R_free r_free	0.4090

The Structure of a plant photosystem I supercomplex at 3.4 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplast

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV A, chloroplast

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplast

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit V, chloroplast

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VI, chloroplast

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer