6zoo

Photosystem I reduced Plastocyanin Complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NFW5_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–743； UniProt 16–758

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt A0A0F6NGI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NGI2_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 2–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P10793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

PsaD

OrganismNot specified

UniProt E1C9K8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9K8_PEA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 6–143； UniProt 1–138

Putative uncharacterized protein

OrganismNot specified

UniProt E1C9K6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9K6_PEA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 3–66； UniProt 1–64

Photosystem I reaction center subunit III

OrganismNot specified

UniProt A0A0M3KL12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL12_PEA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–154； UniProt 1–154

photosystem I reaction center

OrganismNot specified

UniProt A0A0M3KL13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL13_PEA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–97； UniProt 3–95

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–31； UniProt 2–32

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt D5MAL3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAL3_PEA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

Photosystem I reaction center subunit X psaK

OrganismNot specified

UniProt E1C9L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L3_PEA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–81； UniProt 2–82

Chlorophyll a-b binding protein 6, chloroplastic

OrganismNot specified

UniProt Q01667

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAB6_ARATH
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 1； PDBConstruct 1–193； UniProt 47–239

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q41038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 2； PDBConstruct 1–208； UniProt 58–265

Chlorophyll a-b binding protein 3, chloroplastic

OrganismNot specified

UniProt Q32904

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB23_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 3； PDBConstruct 1–221； UniProt 55–275

Chlorophyll a-b binding protein P4, chloroplastic

OrganismNot specified

UniProt Q9SQL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Plastocyanin, chloroplastic × 1 （P16002） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB24_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 4； PDBConstruct 1–198； UniProt 52–249

Plastocyanin, chloroplastic

OrganismNot specified

UniProt P16002

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 （E1C9K8） Putative uncharacterized protein × 1 （E1C9K6） Photosystem I reaction center subunit III × 1 （A0A0M3KL12） photosystem I reaction center × 1 （A0A0M3KL13） Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 CHLOROPHYLL B × 14 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1 COPPER (II) ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLAS_PEA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain P； PDBConstruct 1–99； UniProt 70–168

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6zoo
Deposition date deposition_date	2020-07-07
Structure title title	Photosystem I reduced Plastocyanin Complex
Keywords keywords	Photosystem I, membrane protein, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6zoo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6zoo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6zoo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.07 Å
Rg (electron density)	51.43 Å
Total Rg	51.56 Å
Atom count	38495
Residues	3339
Excluded volume	723520 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6zoo__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (33)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82717.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	38497

PEVKILVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIRPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLVWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIIVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATTSTSLTWGGGDLVSVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSINDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82381.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLSVLPHPQGLGPLFTGQWNLYAQNPDSSNHLFSTSQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAILFLIGGHMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPALNAGRSIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8860.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	PsaD
Molecular weight formula_weight	16041.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGVNFRSIGKNVSPIEVKFTGKQPYDL

Entity 5 Entity 5 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	7479.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	17137.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCKDSKQFAKREKQSIKKLESSLKLYAPDSAPALAINATIEKTKRRFDNYGKQGLLCGADGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDDKKPTQKEIIIDVPLATGLVFRGFSWPIAAYRELLNGELVAKDV

Entity 7 Entity 7 polymer

Description description	photosystem I reaction center
Molecular weight formula_weight	10678.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKF

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VI,Photosystem I reaction center subunit VI
Molecular weight formula_weight	10043.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

YGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKKGPQLPPQLGPRLG

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3409.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

INLPSLFVPLVGLLFPAVAMASLFLHVEKRL

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4767.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit X psaK
Molecular weight formula_weight	8135.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

FIGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGFTLADTLACGVVGHIIGVGVVLGLKNIG

Entity 12 Entity 12 polymer

Description description	PsaL domain-containing protein
Molecular weight formula_weight	16863.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

YQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVGLAHGFLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSICLTIYGISSFNEGDPSTAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAFFLLYVLDLPYF

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein 6, chloroplastic
Molecular weight formula_weight	21335.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

DWMPGQPRPSYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKFHEYKIKEVKNGRLALLAFVGICVQQSAYPGTGPLENLATHLADPWHNTIGNVLIP

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	22845.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

TVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAA

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	24139.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

RPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein P4, chloroplastic
Molecular weight formula_weight	21994.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KKGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL

Entity 17 Entity 17 polymer

Description description	Plastocyanin, chloroplastic
Molecular weight formula_weight	10353.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

VEVLLGASDGGLAFVPSSLEVSAGETIVFKNNAGFPHNVVFDEDEIPAGVDASKISMPEEDLLNAPGETYSVKLDAKGTYKFYCSPHQGAGMVGQVTVN

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	142

Entity 20 Entity 20 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 22 Entity 22 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 23 Entity 23 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 24 Entity 24 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	19

Entity 26 Entity 26 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 28 Entity 28 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 29 Entity 29 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 30 Entity 30 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
Molecular weight formula_weight	705.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 32 Entity 32 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 19 domains

SCOP 2.08 (14 domains)

Domain ID domain_id	d6zoo1_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zoo2_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zoo3_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zoo4_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zooa_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6zoob_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6zooc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d6zood_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d6zooe1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.0 — automated matches

Domain ID domain_id	d6zooe2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d6zoof_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.0 — automated matches

Domain ID domain_id	d6zooj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.0 — automated matches

Domain ID domain_id	d6zool_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.0 — automated matches

Domain ID domain_id	d6zoop_
Class class	b — All beta proteins
Fold Fold fold	b.6 — Cupredoxin-like
Superfamily Superfamily superfamily	b.6.1 — Cupredoxins
Family Family family	b.6.1.1 — Plastocyanin/azurin-like

CATH v4.4 (5 domains)

Domain ID domain_id	6zoo101
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zoo201
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zoo301
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zoo401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zooL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.74 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	104127

Photosystem I reduced Plastocyanin Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PsaD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

photosystem I reaction center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit X psaK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer