4rku

Crystal structure of plant Photosystem I at 3 Angstrom resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–721； UniProt 38–758

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P05311

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–731； UniProt 3–733

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P10793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–26； UniProt 5–30

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt D5MAL3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAL3_PEA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 2–41

Photosystem I reaction center subunit X psaK

OrganismNot specified

UniProt E1C9L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L3_PEA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–72； UniProt 1–72

Photosystem I-N subunit

OrganismNot specified

UniProt E1C9K7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9K7_PEA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain N； PDBConstruct 1–85； UniProt 1–85

Type II chlorophyll a/b binding protein from photosystem I

OrganismNot specified

UniProt Q41038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 2； PDBConstruct 1–199； UniProt 59–257

Chlorophyll a-b binding protein 3, chloroplastic

OrganismNot specified

UniProt Q32904

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB23_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 3； PDBConstruct 1–275； UniProt 1–275

Chlorophyll a-b binding protein P4, chloroplastic

OrganismNot specified

UniProt Q9SQL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Photosystem I reaction center subunit II, chloroplastic × 1 Photosystem I reaction center subunit IV B, chloroplastic × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Photosystem I reaction center subunit VI, chloroplastic × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Photosystem I reaction center subunit XI, chloroplastic × 1 Photosystem I-N subunit × 1 （E1C9K7） Chlorophyll a-b binding protein 6A, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） PHYLLOQUINONE × 2 BETA-CAROTENE × 21 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 CHLOROPHYLL A × 157 IRON/SULFUR CLUSTER × 3 CHLOROPHYLL A ISOMER × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 1 SN-GLYCEROL-3-PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB24_PEA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 4； PDBConstruct 1–196； UniProt 53–248

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4rku
Deposition date deposition_date	2014-10-14
Structure title title	Crystal structure of plant Photosystem I at 3 Angstrom resolution
Keywords keywords	light harvesting, membrane complex, plastocyanin, ferredoxin, chloroplast membrane, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4rku__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4rku__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4rku__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.27 Å
Rg (electron density)	51.56 Å
Total Rg	51.74 Å
Atom count	34540
Residues	3094
Excluded volume	644480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4rku__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	80079.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	34540

GHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIRPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAGLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWARHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAQHMYSMPPYPYLATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATASTSLTWGGGDLVAVGNKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGSINDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82275.6 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

LRIPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPFHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNNAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPSSSNHLFGTTQGAGTAILTILGGFHPQTQSLWLTDMAHHHLAIAFLFLIGGLMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGPIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPALNAGRSIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDDFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYTPLVCNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKF

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8860.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	15348.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

TPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGVNFRSIGKNVSPIEVKFTGKQ

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV B, chloroplastic
Molecular weight formula_weight	7184.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

PIGPKRGAKVKILRQESYWYKGTGSVVTVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEE

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17027.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

SGLTPCKESKQFAKREKQSIKKLESSLKIYAADSAPALAINATIEKTKRRFDNYAKQGLLCGADGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLVFRGFSWPIAAYRELLNGELVAKDV

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	9083.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

PSLVISLSTGLSLFLGRFVFFNFQRENVAKQVPEQNGKGTHFDAGDERAKEYAGLLKSAAAIVDVLAWGSIGHIVAYYLALTTS

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VI, chloroplastic
Molecular weight formula_weight	8895.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

YFDLEDIGNTTGQWDLYGSDAPSPYSPLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSTTASGDILPIVKGPQLPPKL

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	2798.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

PSLFVPLVGLLFPAVAMASLFLHVEK

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4455.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

RDLKTYLSVAPVASTLWFAALAGLLIEINRLFPDALTFPF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit X psaK
Molecular weight formula_weight	7260.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

DFIGSSTNVIMVASTTLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGFTLADTLACGTVGHIIGV

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit XI, chloroplastic
Molecular weight formula_weight	17312.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

SEKPTYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVGLAHGFFLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSICLTIYGISSFNEGDPSTAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVIWAFFLLYVLDLPY

Entity 13 Entity 13 polymer

Description description	Photosystem I-N subunit
Molecular weight formula_weight	9740.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

SVFDAYLEKSKANKELNDKKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISEDLELECEGKDKFKCGSNVFWKW

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein 6A, chloroplastic
Molecular weight formula_weight	20097.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

PRPSYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKFHEYKIKEVKNGRLALLAFVGICVQQSAYPGTGPLENLATHLADPWHNNIG

Entity 15 Entity 15 polymer

Description description	Type II chlorophyll a/b binding protein from photosystem I
Molecular weight formula_weight	21974.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

VAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADP

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	29634.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MATQALVSSSSLTFAAEAVRQSFRARSLPSSVGCSRKGLVRAAATPPVKQGGVDRPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein P4, chloroplastic
Molecular weight formula_weight	21779.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQT

Entity 18 Entity 18 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	21

Entity 20 Entity 20 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 21 Entity 21 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	157

Entity 22 Entity 22 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 23 Entity 23 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 24 Entity 24 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 26 Entity 26 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 27 Entity 27 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 28 Entity 28 non-polymer

Description description	SN-GLYCEROL-3-PHOSPHATE
Molecular weight formula_weight	172.1 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 19 domains

SCOP 2.08 (11 domains)

Domain ID domain_id	d4rku1_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4rku3_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4rku4_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4rkua_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.0 — automated matches

Domain ID domain_id	d4rkub_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d4rkuc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d4rkud_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d4rkue_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.0 — automated matches

Domain ID domain_id	d4rkuf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.0 — automated matches

Domain ID domain_id	d4rkuj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.0 — automated matches

Domain ID domain_id	d4rkul_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.0 — automated matches

CATH v4.4 (8 domains)

Domain ID domain_id	4rkuA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4rkuB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4rkuC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	4rkuD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	4rkuE00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4rkuF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	4rkuJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	4rkuL00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	120.631 Å
Unit-cell length b length_b	189.168 Å
Unit-cell length c length_c	129.667 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.11 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	39.693 Å
R factor r_factor	0.2593
R_work r_work	0.2576
R_free r_free	0.2930

Crystal structure of plant Photosystem I at 3 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit X psaK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I-N subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type II chlorophyll a/b binding protein from photosystem I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein P4, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer