3lw5

Improved model of plant photosystem I

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 Photosystem I reaction center subunit X psaK × 1 Putative uncharacterized protein × 1 Photosystem I-N subunit × 1 CHAIN R × 1 AT3g54890 × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A × 174 PHYLLOQUINONE × 2 BETA-CAROTENE × 19 DODECYL-ALPHA-D-MALTOSIDE × 53 IRON/SULFUR CLUSTER × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–738； UniProt 21–758

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P05311

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 Photosystem I reaction center subunit X psaK × 1 Putative uncharacterized protein × 1 Photosystem I-N subunit × 1 CHAIN R × 1 AT3g54890 × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A × 174 PHYLLOQUINONE × 2 BETA-CAROTENE × 19 DODECYL-ALPHA-D-MALTOSIDE × 53 IRON/SULFUR CLUSTER × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 2–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P10793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 Photosystem I reaction center subunit X psaK × 1 Putative uncharacterized protein × 1 Photosystem I-N subunit × 1 CHAIN R × 1 AT3g54890 × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A × 174 PHYLLOQUINONE × 2 BETA-CAROTENE × 19 DODECYL-ALPHA-D-MALTOSIDE × 53 IRON/SULFUR CLUSTER × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit IX × 1 Photosystem I reaction center subunit X psaK × 1 Putative uncharacterized protein × 1 Photosystem I-N subunit × 1 CHAIN R × 1 AT3g54890 × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A × 174 PHYLLOQUINONE × 2 BETA-CAROTENE × 19 DODECYL-ALPHA-D-MALTOSIDE × 53 IRON/SULFUR CLUSTER × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–30； UniProt 1–30

Type II chlorophyll a/b binding protein from photosystem I

OrganismNot specified

UniProt Q41038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 Photosystem I reaction center subunit X psaK × 1 Putative uncharacterized protein × 1 Photosystem I-N subunit × 1 CHAIN R × 1 AT3g54890 × 1 Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A × 174 PHYLLOQUINONE × 2 BETA-CAROTENE × 19 DODECYL-ALPHA-D-MALTOSIDE × 53 IRON/SULFUR CLUSTER × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 2； PDBConstruct 1–176； UniProt 94–269

Chlorophyll a-b binding protein 3, chloroplastic

OrganismNot specified

UniProt Q32904

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 Photosystem I reaction center subunit X psaK × 1 Putative uncharacterized protein × 1 Photosystem I-N subunit × 1 CHAIN R × 1 AT3g54890 × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A × 174 PHYLLOQUINONE × 2 BETA-CAROTENE × 19 DODECYL-ALPHA-D-MALTOSIDE × 53 IRON/SULFUR CLUSTER × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB23_PEA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 3； PDBConstruct 1–172； UniProt 84–255

Chlorophyll a-b binding protein P4, chloroplastic

OrganismNot specified

UniProt Q9SQL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P05310） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P05311） Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Putative uncharacterized protein × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 Photosystem I reaction center subunit X psaK × 1 Putative uncharacterized protein × 1 Photosystem I-N subunit × 1 CHAIN R × 1 AT3g54890 × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） CHLOROPHYLL A × 174 PHYLLOQUINONE × 2 BETA-CAROTENE × 19 DODECYL-ALPHA-D-MALTOSIDE × 53 IRON/SULFUR CLUSTER × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB24_PEA
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 4； PDBConstruct 1–166； UniProt 81–247

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3lw5
Deposition date deposition_date	2010-02-23
Structure title title	Improved model of plant photosystem I
Keywords keywords	;Photosynthesis, Electron transfer, Membrane proteins, Large, 2 Complexes, Chlorophyll, Chloroplast, Chromophore, Electron transport, Iron, Iron-sulfur, Magnesium, Membrane, Metal-binding, Photosystem I, Thylakoid, Transmembrane, Transport ;; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3lw5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3lw5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3lw5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.52 Å
Rg (electron density)	55.15 Å
Total Rg	55.66 Å
Atom count	36370
Residues	3182
Excluded volume	676130 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3lw5__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (24)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82022.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	36370

LVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAGLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWARHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAQHMYSMPPYPYLATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATASTSLTWGGGDLVAVGNKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTINDQGVVTHITAGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82359.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ALRIPRFSQGIAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPFHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNNAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPSSSNHLFGTTQGAGTAILTILGGFHPQTQSLWLTDVAHHHLAIAFLFLIGGLMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGPIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDIPLSSTNGPALNAGRNIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDDFYLAVFWMLNTIGWVTFYWHWKHITLWRGNVSQFNESSTYLMGWLRDYLWLNSSQLINGITPLVCNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8991.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	15557.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

ELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL

Entity 5 Entity 5 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	7270.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

IGPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEVE

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17299.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF

Entity 7 Entity 7 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	10456.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

SALVISLSTGLSLFLGRFVFFNFQRENVAKQVPEQNGLTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHVVAYYILATTSNGYDPAFF

Entity 8 Entity 8 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	7314.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

DLEDLGNTTGQWDSYGSDAPSPYNPLQSKLFETFAAPFTKRGLLLKFLILGGGSTLAYLSATASGDILP

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3270.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MINLPSLFVPLVGLLFPAVAMASLFLHVEK

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4793.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDLKTYLSVAPVVSTLWFGALAGLLIEINRFFPDALIFPFF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit X psaK
Molecular weight formula_weight	8462.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

DFIGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGVVGHIIGVGVVLGLKNIGAL

Entity 12 Entity 12 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	17059.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

KPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSLCLTIYGISSFNEGAPSTAPSLTLTGRKKEPDQLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLDLPY

Entity 13 Entity 13 polymer

Description description	Photosystem I-N subunit
Molecular weight formula_weight	9767.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

GVIEEYLEKSKTNKELNDKKRLATTGANFARAYTVEFGSCKFPENFTGCQDLAKQKKVPFLSDDLDLECEGKDKYKCGSNVFWKW

Entity 14 Entity 14 polymer

Description description	CHAIN R
Molecular weight formula_weight	4528.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 15 Entity 15 polymer

Description description	AT3g54890
Molecular weight formula_weight	18616.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

SAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWH

Entity 16 Entity 16 polymer

Description description	Type II chlorophyll a/b binding protein from photosystem I
Molecular weight formula_weight	19528.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFTPK

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	18723.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

SDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQN

Entity 18 Entity 18 polymer

Description description	Chlorophyll a-b binding protein P4, chloroplastic
Molecular weight formula_weight	18704.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

LAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQ

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	174

Entity 20 Entity 20 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	19

Entity 22 Entity 22 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	53

Entity 23 Entity 23 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 24 Entity 24 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 11 domains

CATH v4.4 (11 domains)

Domain ID domain_id	3lw5A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	3lw5B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	3lw5C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	3lw5D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	3lw5E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	3lw5F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	3lw5G00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — Chlorophyll a-b binding protein like

Domain ID domain_id	3lw5J00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	3lw5K00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — Chlorophyll a-b binding protein like

Domain ID domain_id	3lw5L00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	3lw5N00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1190 — Chlorophyll A-B binding protein fold
Homologous superfamily homologous superfamily	10 — Chlorophyll A-B binding protein

▶

Unit-cell length a length_a	120.655 Å
Unit-cell length b length_b	189.086 Å
Unit-cell length c length_c	129.388 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.24 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.3510
R_work r_work	0.3490
R_free r_free	0.3830

Improved model of plant photosystem I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type II chlorophyll a/b binding protein from photosystem I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein P4, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3lw5__assembly_1__model_1

3lw5__assembly_1__model_1 | I(q)

3lw5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (24)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer