6zxs

Cold grown Pea Photosystem I

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NFW5_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–743； UniProt 16–758

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt A0A0F6NGI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NGI2_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 2–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P10793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit III

OrganismNot specified

UniProt A0A0M3KL12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL12_PEA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–154； UniProt 1–154

Photosystem I reaction center subunit VI

OrganismNot specified

UniProt A0A0M3KL10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL10_PEA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–88； UniProt 53–140

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–30； UniProt 3–32

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt D5MAL3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAL3_PEA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

Photosystem I reaction center subunit X psaK

OrganismNot specified

UniProt E1C9L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L3_PEA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–80； UniProt 3–82

PsaL domain-containing protein

OrganismNot specified

UniProt E1C9L1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L1_PEA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–157； UniProt 4–160

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q41038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 2； PDBConstruct 1–208； UniProt 58–265

Chlorophyll a-b binding protein 3, chloroplastic

OrganismNot specified

UniProt Q32904

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB23_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 3； PDBConstruct 1–221； UniProt 55–275

Chlorophyll a-b binding protein P4, chloroplastic

OrganismNot specified

UniProt Q9SQL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 Photosystem I reaction center subunit III × 1 （A0A0M3KL12） PsaG × 1 Photosystem I reaction center subunit VI × 1 （A0A0M3KL10） Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL domain-containing protein × 1 （E1C9L1） Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 138 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 DODECYL-BETA-D-MALTOSIDE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 18 GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 5 CALCIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 17 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB24_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 4； PDBConstruct 1–198； UniProt 52–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6zxs
Deposition date deposition_date	2020-07-30
Structure title title	Cold grown Pea Photosystem I
Keywords keywords	PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6zxs__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6zxs__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6zxs__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.74 Å
Rg (electron density)	51.11 Å
Total Rg	51.24 Å
Atom count	37423
Residues	3233
Excluded volume	703660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6zxs__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (31)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82571.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	37423

PEVKILVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIRPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLVWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIIVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATTSTSLTWGGGDLVSVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSINDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82381.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLSVLPHPQGLGPLFTGQWNLYAQNPDSSNHLFSTSQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAILFLIGGHMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPALNAGRSIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8860.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	PsaD
Molecular weight formula_weight	16041.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGVNFRSIGKNVSPIEVKFTGKQPYDL

Entity 5 Entity 5 polymer

Description description	PsaE
Molecular weight formula_weight	7479.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	17137.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCKDSKQFAKREKQSIKKLESSLKLYAPDSAPALAINATIEKTKRRFDNYGKQGLLCGADGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDDKKPTQKEIIIDVPLATGLVFRGFSWPIAAYRELLNGELVAKDV

Entity 7 Entity 7 polymer

Description description	PsaG
Molecular weight formula_weight	10678.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKF

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VI
Molecular weight formula_weight	9491.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

VYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKKGPQLPPQLGPRLG

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3296.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

NLPSLFVPLVGLLFPAVAMASLFLHVEKRL

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4767.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit X psaK
Molecular weight formula_weight	7988.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

IGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGFTLADTLACGVVGHIIGVGVVLGLKNIG

Entity 12 Entity 12 polymer

Description description	PsaL domain-containing protein
Molecular weight formula_weight	16565.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

YQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVGLAHGFLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSICLTIYGISSFNEGDPSTAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVIWAFFLLYVLDLP

Entity 13 Entity 13 polymer

Description description	Lhca1
Molecular weight formula_weight	21335.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

DWMPGQPRPSYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKFHEYKIKEVKNGRLALLAFVGICVQQSAYPGTGPLENLATHLADPWHNTIGNVLIP

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	22845.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

TVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAA

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	24139.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

RPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein P4, chloroplastic
Molecular weight formula_weight	21994.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KKGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL

Entity 17 Entity 17 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	138

Entity 19 Entity 19 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 20 Entity 20 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 22 Entity 22 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 23 Entity 23 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 24 Entity 24 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 25 Entity 25 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 26 Entity 26 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 27 Entity 27 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ;
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 30 Entity 30 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 31 Entity 31 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (13 domains)

Domain ID domain_id	d6zxs1_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zxs2_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zxs3_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zxs4_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6zxsa_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6zxsb_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6zxsc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d6zxsd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d6zxse1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.0 — automated matches

Domain ID domain_id	d6zxse2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d6zxsf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.0 — automated matches

Domain ID domain_id	d6zxsj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.0 — automated matches

Domain ID domain_id	d6zxsl_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.0 — automated matches

CATH v4.4 (5 domains)

Domain ID domain_id	6zxs101
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zxs201
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zxs301
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zxs401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6zxsL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	190.197 Å
Unit-cell length b length_b	201.786 Å
Unit-cell length c length_c	213.614 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	49.630 Å
R factor r_factor	0.2400
R_work r_work	0.2394
R_free r_free	0.2697

Cold grown Pea Photosystem I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit X psaK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PsaL domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer