6yac

Plant PSI-ferredoxin supercomplex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NFW5_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–743； UniProt 16–758

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt A0A0F6NGI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NGI2_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 2–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P10793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–31； UniProt 2–32

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt D5MAL3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAL3_PEA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

Photosystem I reaction center subunit X psaK

OrganismNot specified

UniProt E1C9L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L3_PEA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–81； UniProt 2–82

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q41038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 2； PDBConstruct 1–208； UniProt 58–265

Chlorophyll a-b binding protein 3, chloroplastic

OrganismNot specified

UniProt Q32904

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB23_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 3； PDBConstruct 1–221； UniProt 55–275

Chlorophyll a-b binding protein P4, chloroplastic

OrganismNot specified

UniProt Q9SQL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Ferredoxin-1, chloroplastic × 1 （P09911） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB24_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 4； PDBConstruct 1–198； UniProt 52–249

Ferredoxin-1, chloroplastic

OrganismNot specified

UniProt P09911

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 PsaF × 1 PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） PsaL × 1 Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 141 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 27 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 8 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 19 CALCIUM ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 CHLOROPHYLL B × 15 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FER1_PEA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain N； PDBConstruct 1–97； UniProt 53–149

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6yac
Deposition date deposition_date	2020-03-12
Structure title title	Plant PSI-ferredoxin supercomplex
Keywords keywords	Membrane complex, photosystem I, ferredoxin, light harvesting, excitation transfer, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6yac__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6yac__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6yac__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.55 Å
Rg (electron density)	51.91 Å
Total Rg	52.02 Å
Atom count	38413
Residues	3332
Excluded volume	721830 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6yac__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (33)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82571.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	38469

PEVKILVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIRPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLVWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIIVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATTSTSLTWGGGDLVSVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSINDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82381.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLSVLPHPQGLGPLFTGQWNLYAQNPDSSNHLFSTSQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAILFLIGGHMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPALNAGRSIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8860.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	PsaD
Molecular weight formula_weight	16041.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGVNFRSIGKNVSPIEVKFTGKQPYDL

Entity 5 Entity 5 polymer

Description description	PsaE
Molecular weight formula_weight	7479.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK

Entity 6 Entity 6 polymer

Description description	PsaF
Molecular weight formula_weight	17137.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCKDSKQFAKREKQSIKKLESSLKLYAPDSAPALAINATIEKTKRRFDNYGKQGLLCGADGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDDKKPTQKEIIIDVPLATGLVFRGFSWPIAAYRELLNGELVAKDV

Entity 7 Entity 7 polymer

Description description	PsaG
Molecular weight formula_weight	10678.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKF

Entity 8 Entity 8 polymer

Description description	PsaH
Molecular weight formula_weight	9491.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

VYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKKGPQLPPQLGPRLG

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3409.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

INLPSLFVPLVGLLFPAVAMASLFLHVEKRL

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4767.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit X psaK
Molecular weight formula_weight	8135.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

FIGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGFTLADTLACGVVGHIIGVGVVLGLKNIG

Entity 12 Entity 12 polymer

Description description	PsaL
Molecular weight formula_weight	16565.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

YQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVGLAHGFLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSICLTIYGISSFNEGDPSTAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVIWAFFLLYVLDLP

Entity 13 Entity 13 polymer

Description description	Lhca1
Molecular weight formula_weight	21335.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

DWMPGQPRPSYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKFHEYKIKEVKNGRLALLAFVGICVQQSAYPGTGPLENLATHLADPWHNTIGNVLIP

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	22845.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

TVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAA

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	24139.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

RPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein P4, chloroplastic
Molecular weight formula_weight	21994.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KKGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL

Entity 17 Entity 17 polymer

Description description	Ferredoxin-1, chloroplastic
Molecular weight formula_weight	10359.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

ASYKVKLVTPDGTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDVVIETHKEEDLTA

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	141

Entity 20 Entity 20 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 22 Entity 22 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 23 Entity 23 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 24 Entity 24 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	19

Entity 26 Entity 26 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 28 Entity 28 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 29 Entity 29 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 30 Entity 30 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ;
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 32 Entity 32 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	56

▼

6. Fold Classification (SCOP + CATH) 19 domains

SCOP 2.08 (14 domains)

Domain ID domain_id	d6yac1_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6yac2_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6yac3_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6yac4_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6yaca_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6yacb_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6yacc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d6yacd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d6yace1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.0 — automated matches

Domain ID domain_id	d6yace2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d6yacf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.0 — automated matches

Domain ID domain_id	d6yacj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.0 — automated matches

Domain ID domain_id	d6yacl_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.0 — automated matches

Domain ID domain_id	d6yacn_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.4 — 2Fe-2S ferredoxin-like
Family Family family	d.15.4.1 — 2Fe-2S ferredoxin-related

CATH v4.4 (5 domains)

Domain ID domain_id	6yac101
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yac201
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yac301
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yac401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yacL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	269657

Plant PSI-ferredoxin supercomplex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit X psaK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein P4, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ferredoxin-1, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer