7dkz

Structure of plant photosystem I-light harvesting complex I supercomplex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

Pisum sativum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–269； UniProt 1–269

Chlorophyll a-b binding protein 3, chloroplastic

Pisum sativum

UniProt Q32904

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB23_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–275； UniProt 1–275

Chlorophyll a-b binding protein P4, chloroplastic

Pisum sativum

UniProt Q9SQL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB24_PEA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–198； UniProt 52–249

Photosystem I P700 chlorophyll a apoprotein A1

Pisum sativum

UniProt A0A0F6NFW5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NFW5_PEA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–758； UniProt 1–758

Photosystem I P700 chlorophyll a apoprotein A2

Pisum sativum

UniProt A0A0F6NGI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6NGI2_PEA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

Pisum sativum

UniProt P10793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

PsaE

Pisum sativum

UniProt E1C9K6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9K6_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain E； PDBConstruct 3–61； UniProt 1–59

PSI-F

Pisum sativum

UniProt A0A0M3KL12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL12_PEA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain F； PDBConstruct 1–154； UniProt 1–154

Photosystem I reaction center subunit VIII

Pisum sativum

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain I； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit IX

Pisum sativum

UniProt D5MAL3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） PsaL × 1 PSI-K × 1 （E1C9L3） CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAL3_PEA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

PSI-K

Pisum sativum

UniProt E1C9L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Lhca1 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 （Q9SQL2） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A0F6NFW5） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A0F6NGI2） Photosystem I iron-sulfur center × 1 （P10793） PsaD × 1 PsaE × 1 （E1C9K6） PSI-F × 1 （A0A0M3KL12） PsaG × 1 PsaH × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （D5MAL3） PsaL × 1 CHLOROPHYLL A × 140 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 DODECYL-BETA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 heptyl 1-thio-beta-D-glucopyranoside × 8 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L3_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain K； PDBConstruct 1–80； UniProt 3–82

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7dkz
Deposition date deposition_date	2020-11-25
Structure title title	Structure of plant photosystem I-light harvesting complex I supercomplex
Keywords keywords	PSI-LHCI high plants, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7dkz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7dkz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7dkz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.40 Å
Rg (electron density)	50.68 Å
Total Rg	50.82 Å
Atom count	36000
Residues	3200
Excluded volume	674050 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7dkz__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	Lhca1
Molecular weight formula_weight	21477.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	36093

ADWMPGQPRPSYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKFHEYKIKEVKNGRLALLAFVGICVQQSAYPGTGPLENLATHLADPWHNTIGNVLIPA

Source Source

Source organism organism	Pisum sativum
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28912.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MASACASSAIAAVAISTPSSQKNGSPSGTSKAFLGRKLKVNSSTASPSRVRSTSTVCTVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFTPK

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	29634.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MATQALVSSSSLTFAAEAVRQSFRARSLPSSVGCSRKGLVRAAATPPVKQGGVDRPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 4 Entity 4 polymer

Description description	Chlorophyll a-b binding protein P4, chloroplastic
Molecular weight formula_weight	21994.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KKGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 5 Entity 5 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	84279.6 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MIIRSPEPKVQILADPEVKILVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIRPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLVWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIIVAHHMYAMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATTSTSLTWGGGDLVSVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSINDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 6 Entity 6 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82512.9 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLSVLPHPQGLGPLFTGQWNLYAQNPDSSNHLFSTSQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAILFLIGGHMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPALNAGRSIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 7 Entity 7 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8991.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 8 Entity 8 polymer

Description description	PsaD
Molecular weight formula_weight	16041.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGVNFRSIGKNVSPIEVKFTGKQPYDL

Source Source

Source organism organism	Pisum sativum
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 9 Entity 9 polymer

Description description	PsaE
Molecular weight formula_weight	7479.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

PPIGPKRGAKVKILRQESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 10 Entity 10 polymer

Description description	PSI-F
Molecular weight formula_weight	17238.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCKDSKQFAKREKQSIKKLESSLKLYAPDSAPALAINATIEKTKRRFDNYGKQGLLCGADGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDDKKPTQKEIIIDVPLATRLVFRGFSWPIAAYRELLNGELVAKDV

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 11 Entity 11 polymer

Description description	PsaG
Molecular weight formula_weight	10678.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKF

Source Source

Source organism organism	Pisum sativum
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 12 Entity 12 polymer

Description description	PsaH
Molecular weight formula_weight	9491.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

VYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKKGPQLPPQLGPRLG

Source Source

Source organism organism	Pisum sativum
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 13 Entity 13 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4474.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MINLPSLFVPLVGLLFPAVAMASLFLHVEKRLLFSTKKIN

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4767.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 15 Entity 15 polymer

Description description	PsaL
Molecular weight formula_weight	16565.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

YQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVGLAHGFLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSICLTIYGISSFNEGDPSTAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVIWAFFLLYVLDLP

Source Source

Source organism organism	Pisum sativum
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 16 Entity 16 polymer

Description description	PSI-K
Molecular weight formula_weight	7988.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

IGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGFTLADTLACGVVGHIIGVGVVLGLKNIG

Source Source

Source organism organism	Pisum sativum
Common name common_name	Garden pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 17 Entity 17 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	140

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 19 Entity 19 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 20 Entity 20 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	26

Entity 22 Entity 22 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 23 Entity 23 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 24 Entity 24 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 25 Entity 25 non-polymer

Description description	heptyl 1-thio-beta-D-glucopyranoside
Molecular weight formula_weight	294.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 26 Entity 26 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 29 Entity 29 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	93

▼

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (13 domains)

Domain ID domain_id	d7dkz1_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d7dkz2_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d7dkz3_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d7dkz4_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d7dkza_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d7dkzb_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d7dkzc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d7dkzd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d7dkze1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.0 — automated matches

Domain ID domain_id	d7dkze2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d7dkzf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.0 — automated matches

Domain ID domain_id	d7dkzj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.0 — automated matches

Domain ID domain_id	d7dkzl_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.0 — automated matches

CATH v4.4 (3 domains)

Domain ID domain_id	7dkz101
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7dkz401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7dkzL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	225.652 Å
Unit-cell length b length_b	168.952 Å
Unit-cell length c length_c	185.224 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	121.39 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.393 Å
Low-resolution limit resolution_low	44.405 Å
R factor r_factor	0.1909
R_work r_work	0.1890
R_free r_free	0.2270

Structure of plant photosystem I-light harvesting complex I supercomplex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein P4, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PsaE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PSI-F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer