9gbi

Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein 6, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAB6_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–206； UniProt 36–241

Photosystem I chlorophyll a/b-binding protein 2, chloroplastic

OrganismNot specified

UniProt Q9SYW8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LHCA2_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–214； UniProt 44–257

Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic

OrganismNot specified

UniProt Q9SY97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LHCA3_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–234； UniProt 40–273

Chlorophyll a-b binding protein 4, chloroplastic

OrganismNot specified

UniProt P27521

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CA4_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–199； UniProt 53–251

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

UniProt A0A8F5S1X0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8F5S1X0_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–750； UniProt 1–750

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt A0A8F5P166

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8F5P166_ARATH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P62090

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_ARATH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II-2, chloroplastic

OrganismNot specified

UniProt Q9SA56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD2_ARATH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain D； PDBConstruct 1–160； UniProt 45–204

Photosystem I reaction center subunit IV B, chloroplastic

OrganismNot specified

UniProt Q9S714

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE2_ARATH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain E； PDBConstruct 1–99； UniProt 47–145

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt Q9SHE8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_ARATH
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain F； PDBConstruct 1–154； UniProt 68–221

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt Q9S7N7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_ARATH
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain G； PDBConstruct 1–100； UniProt 61–160

Photosystem I reaction center subunit VI-1, chloroplastic

OrganismNot specified

UniProt Q9SUI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAH1_ARATH
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain H； PDBConstruct 1–95； UniProt 51–145

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P56768

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_ARATH
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain I； PDBConstruct 1–37； UniProt 1–37

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt A0A8F5NZW2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8F5NZW2_ARATH
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain J； PDBConstruct 1–44； UniProt 1–44

Photosystem I reaction center subunit XI, chloroplastic

OrganismNot specified

UniProt Q9SUI4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_ARATH
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain L； PDBConstruct 1–169； UniProt 51–219

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt Q9SUI5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit N, chloroplastic × 1 （P49107） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_ARATH
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain K； PDBConstruct 1–84； UniProt 47–130

Photosystem I reaction center subunit N, chloroplastic

OrganismNot specified

UniProt P49107

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Chlorophyll a-b binding protein 6, chloroplastic × 1 （Q01667） Photosystem I chlorophyll a/b-binding protein 2, chloroplastic × 1 （Q9SYW8） Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic × 1 （Q9SY97） Chlorophyll a-b binding protein 4, chloroplastic × 1 （P27521） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8F5S1X0） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （A0A8F5P166） Photosystem I iron-sulfur center × 1 （P62090） Photosystem I reaction center subunit II-2, chloroplastic × 1 （Q9SA56） Photosystem I reaction center subunit IV B, chloroplastic × 1 （Q9S714） Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit V, chloroplastic × 1 （Q9S7N7） Photosystem I reaction center subunit VI-1, chloroplastic × 1 （Q9SUI7） Photosystem I reaction center subunit VIII × 1 （P56768） Photosystem I reaction center subunit IX × 1 （A0A8F5NZW2） Photosystem I reaction center subunit XI, chloroplastic × 1 （Q9SUI4） Photosystem I reaction center subunit psaK, chloroplastic × 1 （Q9SUI5） CHLOROPHYLL B × 12 CHLOROPHYLL A × 143 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 28 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 DODECYL-BETA-D-MALTOSIDE × 3 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAN_ARATH
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain N； PDBConstruct 1–85； UniProt 87–171

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9gbi
Deposition date deposition_date	2024-07-31
Structure title title	Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type
Keywords keywords	PSI-LHCI, Arabidopsis thaliana, light harvesting, far-red absorption, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9gbi__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9gbi__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9gbi__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.04 Å
Rg (electron density)	52.28 Å
Total Rg	52.40 Å
Atom count	36064
Residues	3230
Excluded volume	673340 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9gbi__assembly_1__model_1`	17-meric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Description description	Chlorophyll a-b binding protein 6, chloroplastic
Molecular weight formula_weight	22522.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	36064

AGNVGRIRMAAHWMPGEPRPAYLDGSAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIPFN

Entity 2 Entity 2 polymer

Description description	Photosystem I chlorophyll a/b-binding protein 2, chloroplastic
Molecular weight formula_weight	23448.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

RAVAADPDRPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDPVFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFTPK

Entity 3 Entity 3 polymer

Description description	Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic
Molecular weight formula_weight	25234.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

KAAATPPVKQGANRPLWFASSQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEIINGRFAMLGAAGAIAPEILGKAGLIPAETALPWFQTGVIPPAGTYTYWADNYTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGLAGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH

Entity 4 Entity 4 polymer

Description description	Chlorophyll a-b binding protein 4, chloroplastic
Molecular weight formula_weight	22274.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN

Entity 5 Entity 5 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83180.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MIIRSPEPEVKILVDRDPIKTSFEEWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWSIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGGLVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATTSTSLTWGGGDLVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSISDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 6 Entity 6 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82448.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MALRFPRFSQGLAQDPTTRRIWFGIATAHDFENHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNGDLYTGALFLLFLSAISLIAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPGSRGEYVRWNNFLGVLPHPQGLGPLFTGQWNLYAQNPDSSSHLFGTSQGTGTAILTLLGGFHPQTQSLWLTDIAHHHLAIAILFLVAGHMYRTNFGIGHSIKDLLEAHIPPGGRLGRGHRGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG

Entity 7 Entity 7 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	9049.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit II-2, chloroplastic
Molecular weight formula_weight	17684.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

EKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQSYDL

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IV B, chloroplastic
Molecular weight formula_weight	10561.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

AAEDTPPATASSDSSSTTAAAAPAKVPAAKAKPPPIGPKRGSKVKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEVK

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17319.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DISGLTPCKDSKQFAKREKQQIKKLESSLKLYAPESAPALALNAQIEKTKRRFDNYGKYGLLCGSDGLPHLIVNGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAISGEKKPAMKEIIIDVPLASRIIFRGFIWPVAAYREFLNGDLIAKDV

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	11000.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

ELSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDRAKEYVSLLKSNDPIGFNIVDVLAWGSIGHIVAYYILATSSNGYDPSFFG

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit VI-1, chloroplastic
Molecular weight formula_weight	10366.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

KYGDKSVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSATSTGEVLPIKRGPQEPPKLGPRGKL

Entity 13 Entity 13 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4137.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTTFNNLPSIFVPLVGLVFPAIAMASLFLHIQKNKIF

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	5022.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDLKTYLSVAPVISTLWFAALAGLLIEINRLFPDALIFPFFSF

Entity 15 Entity 15 polymer

Description description	Photosystem I reaction center subunit XI, chloroplastic
Molecular weight formula_weight	17982.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

AVKSDKTTFQVVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFVKAGPLRNTAYAGSAGSLAAAGLVVILSMCLTIYGISSFKEGEPSIAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYFVK

Entity 16 Entity 16 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	8468.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

DFIGSSTNLIMVTSTTLMLFAGRFGLAPSANRKATAGLRLEARDSGLQTGDPAGFTLADTLACGTVGHIIGVGVVLGLKNIGAI

Entity 17 Entity 17 polymer

Description description	Photosystem I reaction center subunit N, chloroplastic
Molecular weight formula_weight	9720.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

GVIDEYLERSKTNKELNDKKRLATSGANFARAFTVQFGSCKFPENFTGCQDLAKQKKVPFISEDIALECEGKDKYKCGSNVFWKW

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	143

Entity 20 Entity 20 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 21 Entity 21 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 22 Entity 22 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 23 Entity 23 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 24 Entity 24 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 25 Entity 25 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 26 Entity 26 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 28 Entity 28 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.13 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	54155

Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein 6, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I chlorophyll a/b-binding protein 2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein 4, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II-2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV B, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer