8wgh

Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Chlorophyll a-b binding protein 1 × 1 Chlorophyll a-b binding protein 2 × 1 Chlorophyll a-b binding protein 3 × 1 Chlorophyll a-b binding protein 4 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 （G9IB61） Photosystem I iron-sulfur center × 1 （A4QJG7） Photosystem I reaction center subunit II × 1 Photosystem I reaction center subunit IV × 1 Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit VIII × 1 Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （A0A8A9WIB9） Photosystem I reaction center subunit IX × 1 （Q3C1K9） Photosystem I reaction center subunit psaK × 1 Photosystem I reaction center subunit XI × 1 Photosystem I reaction center subunit N × 1 Photosystem I reaction center subunit O × 1 CHLOROPHYLL B × 12 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 heptyl 1-thio-beta-D-glucopyranoside × 10 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DODECYL-BETA-D-MALTOSIDE × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8A0WPY6_9LAMI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–750； UniProt 1–750

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt G9IB61

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Chlorophyll a-b binding protein 1 × 1 Chlorophyll a-b binding protein 2 × 1 Chlorophyll a-b binding protein 3 × 1 Chlorophyll a-b binding protein 4 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8A0WPY6） Photosystem I iron-sulfur center × 1 （A4QJG7） Photosystem I reaction center subunit II × 1 Photosystem I reaction center subunit IV × 1 Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit VIII × 1 Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （A0A8A9WIB9） Photosystem I reaction center subunit IX × 1 （Q3C1K9） Photosystem I reaction center subunit psaK × 1 Photosystem I reaction center subunit XI × 1 Photosystem I reaction center subunit N × 1 Photosystem I reaction center subunit O × 1 CHLOROPHYLL B × 12 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 heptyl 1-thio-beta-D-glucopyranoside × 10 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DODECYL-BETA-D-MALTOSIDE × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9IB61_SESIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt A4QJG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Chlorophyll a-b binding protein 1 × 1 Chlorophyll a-b binding protein 2 × 1 Chlorophyll a-b binding protein 3 × 1 Chlorophyll a-b binding protein 4 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8A0WPY6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （G9IB61） Photosystem I reaction center subunit II × 1 Photosystem I reaction center subunit IV × 1 Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit VIII × 1 Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （A0A8A9WIB9） Photosystem I reaction center subunit IX × 1 （Q3C1K9） Photosystem I reaction center subunit psaK × 1 Photosystem I reaction center subunit XI × 1 Photosystem I reaction center subunit N × 1 Photosystem I reaction center subunit O × 1 CHLOROPHYLL B × 12 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 heptyl 1-thio-beta-D-glucopyranoside × 10 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DODECYL-BETA-D-MALTOSIDE × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_AETCO
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt Q9SHE8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Chlorophyll a-b binding protein 1 × 1 Chlorophyll a-b binding protein 2 × 1 Chlorophyll a-b binding protein 3 × 1 Chlorophyll a-b binding protein 4 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8A0WPY6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （G9IB61） Photosystem I iron-sulfur center × 1 （A4QJG7） Photosystem I reaction center subunit II × 1 Photosystem I reaction center subunit IV × 1 Photosystem I reaction center subunit VIII × 1 Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （A0A8A9WIB9） Photosystem I reaction center subunit IX × 1 （Q3C1K9） Photosystem I reaction center subunit psaK × 1 Photosystem I reaction center subunit XI × 1 Photosystem I reaction center subunit N × 1 Photosystem I reaction center subunit O × 1 CHLOROPHYLL B × 12 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 heptyl 1-thio-beta-D-glucopyranoside × 10 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DODECYL-BETA-D-MALTOSIDE × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_ARATH
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain F； PDBConstruct 1–221； UniProt 1–221

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A0A8A9WIB9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Chlorophyll a-b binding protein 1 × 1 Chlorophyll a-b binding protein 2 × 1 Chlorophyll a-b binding protein 3 × 1 Chlorophyll a-b binding protein 4 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8A0WPY6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （G9IB61） Photosystem I iron-sulfur center × 1 （A4QJG7） Photosystem I reaction center subunit II × 1 Photosystem I reaction center subunit IV × 1 Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit VIII × 1 Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit IX × 1 （Q3C1K9） Photosystem I reaction center subunit psaK × 1 Photosystem I reaction center subunit XI × 1 Photosystem I reaction center subunit N × 1 Photosystem I reaction center subunit O × 1 CHLOROPHYLL B × 12 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 heptyl 1-thio-beta-D-glucopyranoside × 10 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DODECYL-BETA-D-MALTOSIDE × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8A9WIB9_9LAMI
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 1–36

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt Q3C1K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Chlorophyll a-b binding protein 1 × 1 Chlorophyll a-b binding protein 2 × 1 Chlorophyll a-b binding protein 3 × 1 Chlorophyll a-b binding protein 4 × 1 Photosystem I P700 chlorophyll a apoprotein A1 × 1 （A0A8A0WPY6） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （G9IB61） Photosystem I iron-sulfur center × 1 （A4QJG7） Photosystem I reaction center subunit II × 1 Photosystem I reaction center subunit IV × 1 Photosystem I reaction center subunit III, chloroplastic × 1 （Q9SHE8） Photosystem I reaction center subunit VIII × 1 Photosystem I reaction center subunit VI × 1 Photosystem I reaction center subunit VIII × 1 （A0A8A9WIB9） Photosystem I reaction center subunit psaK × 1 Photosystem I reaction center subunit XI × 1 Photosystem I reaction center subunit N × 1 Photosystem I reaction center subunit O × 1 CHLOROPHYLL B × 12 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 BETA-CAROTENE × 26 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 heptyl 1-thio-beta-D-glucopyranoside × 10 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DODECYL-BETA-D-MALTOSIDE × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_NICSY
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain J； PDBConstruct 1–44； UniProt 1–44

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wgh
Deposition date deposition_date	2023-09-21
Structure title title	Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI
Keywords keywords	Complex, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8wgh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8wgh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8wgh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.56 Å
Rg (electron density)	51.86 Å
Total Rg	51.97 Å
Atom count	38187
Residues	3412
Excluded volume	713260 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8wgh__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Description description	Chlorophyll a-b binding protein 1
Molecular weight formula_weight	26773.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	38187

MAANSMMTCGVAVAACPSVLSSSKSRFAAPVSLGYAATTSSRFSMSAEWFPGQPRPDHLDGSAPADFGFDPLGLGVEPELLERYKESEVYHCRWAMLAVPGILVPEALGLGNWVKAQEWAAIPGGQATYLGNPVPWGTLPTILVIEFLAIAFVEHQRTLEKDIEKKKYPGGAFDPLGFSKDPKKFEEYKVKEIKNGRLAMLAFVGFCVQQSARPGTGPVENLLSHLADPWHNNIGDIIIPRNISPY

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein 2
Molecular weight formula_weight	28533.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MASACASSAIAAAFSSPSSQRIGTTKASFFGGRKLRVAKFAAPVTARSVTTATFAPDPNRPLWFPGSTPPPWLDGSLPADFGFDPLGLASDPDSLKWNVQAEIVHCRWAMLGAAGIFIPELLTKIGILNTPSWYSAGELQYFTDTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGTGSPEKLKELRTKEIKNGRLAMLAVMGAWFQHVYTGTGPIDNLSAHLADPGHATVFAAFSPK

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein 3
Molecular weight formula_weight	29766.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAAQALVSSSSICSSADAVRQTLGRRPVRSSRKASFVVKAESSPPVKQGADRQLWFASKQSLSYLNGSLPGDYGFDPLGLSDPEGAGFWFQPRWLSYGEVFNGRTAMVGVIGCLAPEILGKAGLIPPETALPWFKTGVFPPAGSYEYWADPYTLFVFELGLVGFAEHRRYQDWSNPGSMGKQYFLGLEKGLGGSGDPAYPGGPFFNPLGLGKDEKSMWDYKVKEVKNGRLAMLAMLGFFVQAPVTGVGPYQNLLDHLADPFNNNIFTNFKFY

Entity 4 Entity 4 polymer

Description description	Chlorophyll a-b binding protein 4
Molecular weight formula_weight	27510.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAASVAAQSPVAVFRPRFLTGAPGKLNRPSVTVKQAVSSRGSFKVEAEKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLKWYIQAELVNSRWAMLGVAGMLLPEVFTYLGIINVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKNYSLPPHECGYPGSVFNPLNFEPTLEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFDNLVQHVADPWHNTIINTIRGY

Entity 5 Entity 5 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83138.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MIIRSPEPEVKILVDKDPVKTSFEEWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQMWRASGITSELQLYCTAIGALIFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLGWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLSQLYPSFAEGATPFFTLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGATAPSATASTSLTWGGGDLVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGSISDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 6 Entity 6 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82472.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFESWVQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSAISLIAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPGSRGEYVRWNNFLDVLPHPQGLGPLFTGQWNLYAQNPDSSSHLFGTSQGAGTAILTLLGGFHPQTQSLWLTDIAHHHLAIAFIFLVAGHMYRTNFGIGHSIKDLLDAHIPPGGRLGRGHKGLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTSGPAFNAGRSIWLPGWLNAVNENTNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG

Entity 7 Entity 7 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	9049.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	21036.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MASLFTLSSPWKQSLAPQFTAAKNPKPLPRAVAMPIRAMAPEESAPAGFTPPQLDPSTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNEGRTGVGVNLRSIGKNVNPIEVKFTGKQVYDL

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	16282.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MATTGMASAACTFAVAPNFASSTATPKPAMVFFSTKPRRNLRLFMVRAGDDEPEAPAPPPEPEVESDTPAAATATTTAEPKVAKTPSVGPPRGSKVRILRRESYWYKGVGSVVTVDQDPKTRYPVVVRFDKVNYANISTNNYALDEVEQVA

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	24203.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSLTIPANLVLNPRSNKSLTQSVPKSSARFVCSDDKSSSSTPQSMKAFSAAVALSSILLSAPMPAVADISGLTPCKDSKQFAKREKQQIKKLESSLKLYAPESAPALALNAQIEKTKRRFDNYGKYGLLCGSDGLPHLIVNGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAISGEKKPAMKEIIIDVPLASRIIFRGFIWPVAAYREFLNGDLIAKDV

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	15874.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MASSFLSTPTFQGLRPLNKATDSPRSLPLCRPVSVSATRKRNVAVKAELNPSLVISLSTGVSLFLGRFVFFNFQRENVGKQVPSQNGISHFEAGDERAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPNFF

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit VI
Molecular weight formula_weight	15201.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MASLATFAAAHPAAVKGLAGSSISGTKLHIRPSRRVGVKSSNYRAGAVVAKYGEKSVYFDLEDIANTTGQWDVYGSDAPSPYNGLQSKFFETFAAPFTKRGLLLKFLLLGGGATLAFVSSQATGDDLPIVKGPQLPPQPGPRGKI

Entity 13 Entity 13 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3930.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTAFNLPSIFVPLVGLVFPAIAMASLFLHVQKNKIV

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	5029.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDLKTYLSVAPVLSTLWFGALAGLLIEINRFFPDALTFPFFSF

Entity 15 Entity 15 polymer

Description description	Photosystem I reaction center subunit psaK
Molecular weight formula_weight	13435.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAAAVTTSLPQFNGLKPQLSASSISPSKSLVAVRPLRRRGQGALGARCDYFGSPTNLIMVTSTTLLLFAGRFGLAPSANRKATAGLKLEVRDAGLQTGDPAGFTLADTLACGAVGHIIGVGVVLGLKSISVI

Entity 16 Entity 16 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	23094.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MATSTMASLGQQQLASSLCPSFSRLPTPKGISAAPFTFSRRRTSIIKASVVPEKPTYQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPGYRTAVDPLLRGIEVGLAHGYLLVGPFVITGPLRNAPNHGAVGSLGAAGLIVILSITLTMYGIASFKEGDPSTAPSLTLTGRKKVPDPLQTADGWARFTGGFFFGGISGVIWAYFLLYVLDLPYFVK

Entity 17 Entity 17 polymer

Description description	Photosystem I reaction center subunit N
Molecular weight formula_weight	18673.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MAAINSSSVLACNYALSAAGTELSSKVVNSVASPVSVAHPPRLPVIRAQQQQQPQSAAAGSRRAALFGLGAALLAVSTNANANASVIDYYLEKSKANKELNDKKRLATTDANFARAYTVEFGTCKFPENFTGCQDLAKQKKVPFLSEDLDIECEGKDIYKCGSNVFWKWNEIK

Entity 18 Entity 18 polymer

Description description	Photosystem I reaction center subunit O
Molecular weight formula_weight	15404.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAASTMAAASTVVGLGTSSLIAPKKLNLSSGFLKSPIQARNPLRLAQASGGKFTCFERDWLRTDLNVIGFGLIGWLAPSSIPAINGNSLTGLFFSSIGPELAHFPTGPAVTSPFWLWMVLWHLGLFLTLTFGQIGFKGRSEGYF

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 20 Entity 20 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	150

Entity 21 Entity 21 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 22 Entity 22 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 23 Entity 23 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	26

Entity 24 Entity 24 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 26 Entity 26 non-polymer

Description description	heptyl 1-thio-beta-D-glucopyranoside
Molecular weight formula_weight	294.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 27 Entity 27 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 29 Entity 29 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	157342

Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8wgh__assembly_1__model_1

8wgh__assembly_1__model_1 | I(q)

8wgh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer