SAXSdb — 9h72

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csn2

Streptococcus thermophilus DGCC 7710

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 7 DNA 2	CRISPR-associated endoribonuclease Cas2 × 1 （G3ECR3） CRISPR-associated endonuclease Cas1 × 2 （G3ECR2） double-stranded DNA, chain 1 × 1 Double-stranded DNA, strand 2 × 1 CALCIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN2_STRTR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain L； PDBConstruct 17–235； UniProt 1–219 Author chain M； PDBConstruct 17–235； UniProt 1–219 Author chain N； PDBConstruct 17–235； UniProt 1–219 Author chain O； PDBConstruct 17–235； UniProt 1–219

CRISPR-associated endoribonuclease Cas2

Streptococcus thermophilus DGCC 7710

UniProt G3ECR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 7 DNA 2	CRISPR-associated protein Csn2 × 4 （G3ECR4） CRISPR-associated endonuclease Cas1 × 2 （G3ECR2） double-stranded DNA, chain 1 × 1 Double-stranded DNA, strand 2 × 1 CALCIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAS2_STRTR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–114； UniProt 1–114

CRISPR-associated endonuclease Cas1

Streptococcus thermophilus DGCC 7710

UniProt G3ECR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 7 DNA 2	CRISPR-associated protein Csn2 × 4 （G3ECR4） CRISPR-associated endoribonuclease Cas2 × 1 （G3ECR3） double-stranded DNA, chain 1 × 1 Double-stranded DNA, strand 2 × 1 CALCIUM ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAS1_STRTR
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–289； UniProt 1–289 Author chain C； PDBConstruct 1–289； UniProt 1–289

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9h72
Deposition date deposition_date	2024-10-25
Structure title title	Csn2 (point mutations Y212R, I213R and M215R) in complex with Cas1-Cas2 integrase and dsDNA, Streptococcus thermophilus DGCC 7710 CRISPR3 system
Keywords keywords	CIRSPR-Cas, spacer acquisition, Csn2, Cas1, Cas2, CRISPR integrase, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9h72__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9h72__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9h72__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.78 Å
Rg (electron density)	44.05 Å
Total Rg	43.90 Å
Atom count	11093
Residues	1484
Excluded volume	198760 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9h72__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	CRISPR-associated protein Csn2
Molecular weight formula_weight	27523.6 kDa
Mutation mutation	Y212R, I213R, M215R
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,L,N,M
Atom count atom_count	11093

MGHHHHHHENLYFQGGMKINFSLLDEPMEVNLGTVLVIEDVSVFAQLVKEFYQYDEQSNLTIFDSKIRSIRSSELLLITDILGYDINTSQVLKLLHTDIVSQLNDKPEVRSEIDSLVSLITDIIMAECIENELDIEYDEITLLELIKALGVRIETKSCTVFEKIFEILQIFKYLVKKRILVFVNSLSYFSKDEIYQILEYTKLSQADVLFLEPRQIEGIQQFILDKDRRLRPYNN

Source Source

Source organism organism	Streptococcus thermophilus DGCC 7710
NCBI taxonomy ID ncbi_taxonomy_id	1268061
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	CRISPR-associated endoribonuclease Cas2
Molecular weight formula_weight	13431.6 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSYRYMRMILMFDMPTDTAEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNHTANTAMVGRLKANNPKKGNITILTVTEKQFARMIYLYGDKNTSIANSEERLVFLGDNYCDED

Source Source

Source organism organism	Streptococcus thermophilus DGCC 7710
NCBI taxonomy ID ncbi_taxonomy_id	1268061
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	CRISPR-associated endonuclease Cas1
Molecular weight formula_weight	35363.5 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MAGWRTVVVNIHSKLSYKNNHLIFRNSYKTEMIHLSEIDILLLETTDIVLTTMLVKRLVDENILVIFCDDKRLPTAFLTPYYARHDSSLQIARQIAWKENVKCEVWTAIIAQKILNQSYYLGECSFFEKSQSIMELYHGLERFDPSNREGHSARIYFNTLFGNDFTRESDNDINAALDYGYTLLLSMFAREVVVCGCMTQIGLKHANQFNQFNLASDIMEPFRPIIDRIVYQNRHNNFVKIKKELFSIFSETYLYNGKEMYLSNIVSDYTKKVIKALNQLGEEIPEFRILESGWSHPQFEKA

Source Source

Source organism organism	Streptococcus thermophilus DGCC 7710
NCBI taxonomy ID ncbi_taxonomy_id	1268061
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	double-stranded DNA, chain 1
Molecular weight formula_weight	9103.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

AGACCCACGCTCACCGGTTCCAGATTTATC

Entity 5 Entity 5 polymer

Description description	Double-stranded DNA, strand 2
Molecular weight formula_weight	9344.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E

GATAAATCTGGAACCGGTGAGCGTGGGTCT

Entity 6 Entity 6 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.38 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	92588

Csn2 (point mutations Y212R, I213R and M215R) in complex with Cas1-Cas2 integrase and dsDNA, Streptococcus thermophilus DGCC 7710 CRISPR3 system

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csn2

State in the Current Structure

Other States of the Same Protein in the Database

CRISPR-associated endoribonuclease Cas2

State in the Current Structure

Other States of the Same Protein in the Database

CRISPR-associated endonuclease Cas1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9h72__assembly_1__model_1

9h72__assembly_1__model_1 | I(q)

9h72__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Csn2 (point mutations Y212R, I213R and M215R) in complex with Cas1-Cas2 integrase and dsDNA, Streptococcus thermophilus DGCC 7710 CRISPR3 system

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csn2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated endoribonuclease Cas2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated endonuclease Cas1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9h72__assembly_1__model_1

9h72__assembly_1__model_1 | I(q)

9h72__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)