SAXSdb — 9hz7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail sheath protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Structural protein × 12 （J7F8Z8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7FA80_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–503； UniProt 1–503 Author chain B； PDBConstruct 1–503； UniProt 1–503 Author chain C； PDBConstruct 1–503； UniProt 1–503 Author chain D； PDBConstruct 1–503； UniProt 1–503 Author chain E； PDBConstruct 1–503； UniProt 1–503 Author chain F； PDBConstruct 1–503； UniProt 1–503 Author chain G； PDBConstruct 1–503； UniProt 1–503 Author chain H； PDBConstruct 1–503； UniProt 1–503 Author chain I； PDBConstruct 1–503； UniProt 1–503 Author chain J； PDBConstruct 1–503； UniProt 1–503 Author chain K； PDBConstruct 1–503； UniProt 1–503 Author chain L； PDBConstruct 1–503； UniProt 1–503

Structural protein

OrganismNot specified

UniProt J7F8Z8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Tail sheath protein × 12 （J7FA80）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J7F8Z8_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain M； PDBConstruct 1–136； UniProt 1–136 Author chain N； PDBConstruct 1–136； UniProt 1–136 Author chain O； PDBConstruct 1–136； UniProt 1–136 Author chain P； PDBConstruct 1–136； UniProt 1–136 Author chain Q； PDBConstruct 1–136； UniProt 1–136 Author chain R； PDBConstruct 1–136； UniProt 1–136 Author chain S； PDBConstruct 1–136； UniProt 1–136 Author chain T； PDBConstruct 1–136； UniProt 1–136 Author chain U； PDBConstruct 1–136； UniProt 1–136 Author chain V； PDBConstruct 1–136； UniProt 1–136 Author chain W； PDBConstruct 1–136； UniProt 1–136 Author chain X； PDBConstruct 1–136； UniProt 1–136

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hz7
Deposition date deposition_date	2025-01-13
Structure title title	Agrobacterium phage 7-7-1 tail
Keywords keywords	Flagella phage, Agrobacterium sp. H13-3, Tail, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hz7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hz7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hz7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.73 Å
Rg (electron density)	72.34 Å
Total Rg	72.37 Å
Atom count	112752
Residues	7596
Excluded volume	1010900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hz7__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Tail sheath protein
Molecular weight formula_weight	54120.4 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,A,B,C,D,E,F,G,H,I,J,K
Atom count atom_count	112752

MAQDALSDGFVRLCIDPSLNFFGEGCKILVEGQITDDATAAENVVTCVNSELDLVERFGQGSVLTESLRKVFCMCKSGVSVYALPRADAAAAVSAVYTLTVTGTALTDGRVQLYMGEAEYSLDIGVDEGDTPTQIAAKIVAAISPDFPYEATAAAGVITLTARNGGTIGNHLSVIYTNLGSCTSVTPEGVTVAFAQTTPGSVNPEPNDYASVVNECCFAVYVLSSDDTDWQENLRDWIRSAWDCSKPQCFGHGYVFNKGTLGQVLADGDNSAELSRLALPTTYPVLPYLTNAAYGALSACSTCENPELNVQGQTYGLLSCINMPESCTPGWEFTEVTQLQNNGFVVSGPATTSGQGNFTSPYIYNDVTNYLRDEKNRPNATFRDASSRRLAAATGVALATFLQQFNGLAVFTKNTNIKTGIIGTNLRLMLGKIRKWASDNVGVLFSEFDNINEDIQLVSDFDVQPKCVGQPGVFHLNMRYRPPVRGARINVNLVPALFDNCDR

Entity 2 Entity 2 polymer

Description description	Structural protein
Molecular weight formula_weight	14503.3 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O,P,Q,R,S,T,U,V,W,X

MACNKQNGVKNILITFTHCDTGEVIGPISHEQPDDTLPTYKTCAWTNTALTNGAVMRSASNATMTLPVVRDPRVPLAWYQGCAQIDAQVEKFDGTVMTLTEGAVTEPEESDGRAVTMTIIAAEIDELLPPGSLAAA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.03 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	21858

Agrobacterium phage 7-7-1 tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Structural protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hz7__assembly_1__model_1

9hz7__assembly_1__model_1 | I(q)

9hz7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (2)

Agrobacterium phage 7-7-1 tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Structural protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hz7__assembly_1__model_1

9hz7__assembly_1__model_1 | I(q)

9hz7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (2)