9k9w

structure of bundle-shaped PBS with short rod

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin beta subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL79_GLOVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–161； UniProt 1–161 Author chain B5； PDBConstruct 1–161； UniProt 1–161 Author chain B7； PDBConstruct 1–161； UniProt 1–161 Author chain D5； PDBConstruct 1–161； UniProt 1–161 Author chain D7； PDBConstruct 1–161； UniProt 1–161 Author chain F5； PDBConstruct 1–161； UniProt 1–161 Author chain F7； PDBConstruct 1–161； UniProt 1–161 Author chain H5； PDBConstruct 1–161； UniProt 1–161 Author chain H7； PDBConstruct 1–161； UniProt 1–161 Author chain J5； PDBConstruct 1–161； UniProt 1–161 Author chain J7； PDBConstruct 1–161； UniProt 1–161 Author chain L5； PDBConstruct 1–161； UniProt 1–161 Author chain L7； PDBConstruct 1–161； UniProt 1–161 Author chain N5； PDBConstruct 1–161； UniProt 1–161 Author chain N7； PDBConstruct 1–161； UniProt 1–161 Author chain P5； PDBConstruct 1–161； UniProt 1–161 Author chain P7； PDBConstruct 1–161； UniProt 1–161 Author chain R5； PDBConstruct 1–161； UniProt 1–161 Author chain R7； PDBConstruct 1–161； UniProt 1–161 Author chain T5； PDBConstruct 1–161； UniProt 1–161 Author chain T7； PDBConstruct 1–161； UniProt 1–161 Author chain V5； PDBConstruct 1–161； UniProt 1–161 Author chain V7； PDBConstruct 1–161； UniProt 1–161 Author chain X5； PDBConstruct 1–161； UniProt 1–161 Author chain X7； PDBConstruct 1–161； UniProt 1–161 Author chain Z； PDBConstruct 1–161； UniProt 1–161 Author chain Z5； PDBConstruct 1–161； UniProt 1–161 Author chain Z7； PDBConstruct 1–161； UniProt 1–161 Author chain b5； PDBConstruct 1–161； UniProt 1–161 Author chain b7； PDBConstruct 1–161； UniProt 1–161 Author chain d5； PDBConstruct 1–161； UniProt 1–161 Author chain d7； PDBConstruct 1–161； UniProt 1–161 Author chain f5； PDBConstruct 1–161； UniProt 1–161 Author chain f7； PDBConstruct 1–161； UniProt 1–161 Author chain h7； PDBConstruct 1–161； UniProt 1–161 Author chain j7； PDBConstruct 1–161； UniProt 1–161 Author chain l7； PDBConstruct 1–161； UniProt 1–161 Author chain n7； PDBConstruct 1–161； UniProt 1–161 Author chain p7； PDBConstruct 1–161； UniProt 1–161 Author chain r7； PDBConstruct 1–161； UniProt 1–161 Author chain t7； PDBConstruct 1–161； UniProt 1–161 Author chain v7； PDBConstruct 1–161； UniProt 1–161

Phycocyanin alpha chain

OrganismNot specified

UniProt Q7M7F7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7M7F7_GLOVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A1； PDBConstruct 1–162； UniProt 1–162 Author chain A2； PDBConstruct 1–162； UniProt 1–162 Author chain A3； PDBConstruct 1–162； UniProt 1–162 Author chain A4； PDBConstruct 1–162； UniProt 1–162 Author chain A6； PDBConstruct 1–162； UniProt 1–162 Author chain A8； PDBConstruct 1–162； UniProt 1–162 Author chain A9； PDBConstruct 1–162； UniProt 1–162 Author chain AA； PDBConstruct 1–162； UniProt 1–162 Author chain C1； PDBConstruct 1–162； UniProt 1–162 Author chain C2； PDBConstruct 1–162； UniProt 1–162 Author chain C3； PDBConstruct 1–162； UniProt 1–162 Author chain C4； PDBConstruct 1–162； UniProt 1–162 Author chain C6； PDBConstruct 1–162； UniProt 1–162 Author chain C8； PDBConstruct 1–162； UniProt 1–162 Author chain C9； PDBConstruct 1–162； UniProt 1–162 Author chain CA； PDBConstruct 1–162； UniProt 1–162 Author chain E1； PDBConstruct 1–162； UniProt 1–162 Author chain E2； PDBConstruct 1–162； UniProt 1–162 Author chain E3； PDBConstruct 1–162； UniProt 1–162 Author chain E4； PDBConstruct 1–162； UniProt 1–162 Author chain E6； PDBConstruct 1–162； UniProt 1–162 Author chain E8； PDBConstruct 1–162； UniProt 1–162 Author chain E9； PDBConstruct 1–162； UniProt 1–162 Author chain EA； PDBConstruct 1–162； UniProt 1–162 Author chain G1； PDBConstruct 1–162； UniProt 1–162 Author chain G2； PDBConstruct 1–162； UniProt 1–162 Author chain G3； PDBConstruct 1–162； UniProt 1–162 Author chain G4； PDBConstruct 1–162； UniProt 1–162 Author chain G6； PDBConstruct 1–162； UniProt 1–162 Author chain G8； PDBConstruct 1–162； UniProt 1–162 Author chain G9； PDBConstruct 1–162； UniProt 1–162 Author chain GA； PDBConstruct 1–162； UniProt 1–162 Author chain I1； PDBConstruct 1–162； UniProt 1–162 Author chain I2； PDBConstruct 1–162； UniProt 1–162 Author chain I3； PDBConstruct 1–162； UniProt 1–162 Author chain I4； PDBConstruct 1–162； UniProt 1–162 Author chain I6； PDBConstruct 1–162； UniProt 1–162 Author chain I8； PDBConstruct 1–162； UniProt 1–162 Author chain I9； PDBConstruct 1–162； UniProt 1–162 Author chain IA； PDBConstruct 1–162； UniProt 1–162 Author chain K1； PDBConstruct 1–162； UniProt 1–162 Author chain K2； PDBConstruct 1–162； UniProt 1–162 Author chain K3； PDBConstruct 1–162； UniProt 1–162 Author chain K4； PDBConstruct 1–162； UniProt 1–162 Author chain K6； PDBConstruct 1–162； UniProt 1–162 Author chain K8； PDBConstruct 1–162； UniProt 1–162 Author chain K9； PDBConstruct 1–162； UniProt 1–162 Author chain KA； PDBConstruct 1–162； UniProt 1–162 Author chain N4； PDBConstruct 1–162； UniProt 1–162 Author chain N8； PDBConstruct 1–162； UniProt 1–162 Author chain O1； PDBConstruct 1–162； UniProt 1–162 Author chain O3； PDBConstruct 1–162； UniProt 1–162 Author chain O9； PDBConstruct 1–162； UniProt 1–162 Author chain OA； PDBConstruct 1–162； UniProt 1–162 Author chain P4； PDBConstruct 1–162； UniProt 1–162 Author chain P8； PDBConstruct 1–162； UniProt 1–162 Author chain Q1； PDBConstruct 1–162； UniProt 1–162 Author chain Q3； PDBConstruct 1–162； UniProt 1–162 Author chain Q9； PDBConstruct 1–162； UniProt 1–162 Author chain QA； PDBConstruct 1–162； UniProt 1–162 Author chain R4； PDBConstruct 1–162； UniProt 1–162 Author chain R8； PDBConstruct 1–162； UniProt 1–162 Author chain S1； PDBConstruct 1–162； UniProt 1–162 Author chain S3； PDBConstruct 1–162； UniProt 1–162 Author chain S9； PDBConstruct 1–162； UniProt 1–162 Author chain SA； PDBConstruct 1–162； UniProt 1–162 Author chain T4； PDBConstruct 1–162； UniProt 1–162 Author chain T8； PDBConstruct 1–162； UniProt 1–162 Author chain U1； PDBConstruct 1–162； UniProt 1–162 Author chain U3； PDBConstruct 1–162； UniProt 1–162 Author chain U9； PDBConstruct 1–162； UniProt 1–162 Author chain UA； PDBConstruct 1–162； UniProt 1–162 Author chain V4； PDBConstruct 1–162； UniProt 1–162 Author chain V8； PDBConstruct 1–162； UniProt 1–162 Author chain W1； PDBConstruct 1–162； UniProt 1–162 Author chain W3； PDBConstruct 1–162； UniProt 1–162 Author chain W9； PDBConstruct 1–162； UniProt 1–162 Author chain WA； PDBConstruct 1–162； UniProt 1–162 Author chain X4； PDBConstruct 1–162； UniProt 1–162 Author chain X8； PDBConstruct 1–162； UniProt 1–162 Author chain Y1； PDBConstruct 1–162； UniProt 1–162 Author chain Y3； PDBConstruct 1–162； UniProt 1–162 Author chain Y9； PDBConstruct 1–162； UniProt 1–162 Author chain YA； PDBConstruct 1–162； UniProt 1–162

Phycocyanin beta chain

OrganismNot specified

UniProt Q7M7C7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7M7C7_GLOVI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B1； PDBConstruct 1–172； UniProt 1–172 Author chain B2； PDBConstruct 1–172； UniProt 1–172 Author chain B3； PDBConstruct 1–172； UniProt 1–172 Author chain B4； PDBConstruct 1–172； UniProt 1–172 Author chain B6； PDBConstruct 1–172； UniProt 1–172 Author chain B8； PDBConstruct 1–172； UniProt 1–172 Author chain B9； PDBConstruct 1–172； UniProt 1–172 Author chain BA； PDBConstruct 1–172； UniProt 1–172 Author chain D1； PDBConstruct 1–172； UniProt 1–172 Author chain D2； PDBConstruct 1–172； UniProt 1–172 Author chain D3； PDBConstruct 1–172； UniProt 1–172 Author chain D4； PDBConstruct 1–172； UniProt 1–172 Author chain D6； PDBConstruct 1–172； UniProt 1–172 Author chain D8； PDBConstruct 1–172； UniProt 1–172 Author chain D9； PDBConstruct 1–172； UniProt 1–172 Author chain DA； PDBConstruct 1–172； UniProt 1–172 Author chain F1； PDBConstruct 1–172； UniProt 1–172 Author chain F2； PDBConstruct 1–172； UniProt 1–172 Author chain F3； PDBConstruct 1–172； UniProt 1–172 Author chain F4； PDBConstruct 1–172； UniProt 1–172 Author chain F6； PDBConstruct 1–172； UniProt 1–172 Author chain F8； PDBConstruct 1–172； UniProt 1–172 Author chain F9； PDBConstruct 1–172； UniProt 1–172 Author chain FA； PDBConstruct 1–172； UniProt 1–172 Author chain H1； PDBConstruct 1–172； UniProt 1–172 Author chain H2； PDBConstruct 1–172； UniProt 1–172 Author chain H3； PDBConstruct 1–172； UniProt 1–172 Author chain H4； PDBConstruct 1–172； UniProt 1–172 Author chain H6； PDBConstruct 1–172； UniProt 1–172 Author chain H8； PDBConstruct 1–172； UniProt 1–172 Author chain H9； PDBConstruct 1–172； UniProt 1–172 Author chain HA； PDBConstruct 1–172； UniProt 1–172 Author chain J1； PDBConstruct 1–172； UniProt 1–172 Author chain J2； PDBConstruct 1–172； UniProt 1–172 Author chain J3； PDBConstruct 1–172； UniProt 1–172 Author chain J4； PDBConstruct 1–172； UniProt 1–172 Author chain J6； PDBConstruct 1–172； UniProt 1–172 Author chain J8； PDBConstruct 1–172； UniProt 1–172 Author chain J9； PDBConstruct 1–172； UniProt 1–172 Author chain JA； PDBConstruct 1–172； UniProt 1–172 Author chain L1； PDBConstruct 1–172； UniProt 1–172 Author chain L2； PDBConstruct 1–172； UniProt 1–172 Author chain L3； PDBConstruct 1–172； UniProt 1–172 Author chain L4； PDBConstruct 1–172； UniProt 1–172 Author chain L6； PDBConstruct 1–172； UniProt 1–172 Author chain L8； PDBConstruct 1–172； UniProt 1–172 Author chain L9； PDBConstruct 1–172； UniProt 1–172 Author chain LA； PDBConstruct 1–172； UniProt 1–172 Author chain O4； PDBConstruct 1–172； UniProt 1–172 Author chain O8； PDBConstruct 1–172； UniProt 1–172 Author chain P1； PDBConstruct 1–172； UniProt 1–172 Author chain P3； PDBConstruct 1–172； UniProt 1–172 Author chain P9； PDBConstruct 1–172； UniProt 1–172 Author chain PA； PDBConstruct 1–172； UniProt 1–172 Author chain Q4； PDBConstruct 1–172； UniProt 1–172 Author chain Q8； PDBConstruct 1–172； UniProt 1–172 Author chain R1； PDBConstruct 1–172； UniProt 1–172 Author chain R3； PDBConstruct 1–172； UniProt 1–172 Author chain R9； PDBConstruct 1–172； UniProt 1–172 Author chain RA； PDBConstruct 1–172； UniProt 1–172 Author chain S4； PDBConstruct 1–172； UniProt 1–172 Author chain S8； PDBConstruct 1–172； UniProt 1–172 Author chain T1； PDBConstruct 1–172； UniProt 1–172 Author chain T3； PDBConstruct 1–172； UniProt 1–172 Author chain T9； PDBConstruct 1–172； UniProt 1–172 Author chain TA； PDBConstruct 1–172； UniProt 1–172 Author chain U4； PDBConstruct 1–172； UniProt 1–172 Author chain U8； PDBConstruct 1–172； UniProt 1–172 Author chain V1； PDBConstruct 1–172； UniProt 1–172 Author chain V3； PDBConstruct 1–172； UniProt 1–172 Author chain V9； PDBConstruct 1–172； UniProt 1–172 Author chain VA； PDBConstruct 1–172； UniProt 1–172 Author chain W4； PDBConstruct 1–172； UniProt 1–172 Author chain W8； PDBConstruct 1–172； UniProt 1–172 Author chain X1； PDBConstruct 1–172； UniProt 1–172 Author chain X3； PDBConstruct 1–172； UniProt 1–172 Author chain X9； PDBConstruct 1–172； UniProt 1–172 Author chain XA； PDBConstruct 1–172； UniProt 1–172 Author chain Y4； PDBConstruct 1–172； UniProt 1–172 Author chain Y8； PDBConstruct 1–172； UniProt 1–172 Author chain Z1； PDBConstruct 1–172； UniProt 1–172 Author chain Z3； PDBConstruct 1–172； UniProt 1–172 Author chain Z9； PDBConstruct 1–172； UniProt 1–172 Author chain ZA； PDBConstruct 1–172； UniProt 1–172

Phycocyanin-associated rod linker protein

OrganismNot specified

UniProt Q7NGF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NGF2_GLOVI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain M1； PDBConstruct 56–274； UniProt 1–219 Author chain M3； PDBConstruct 56–274； UniProt 1–219 Author chain M4； PDBConstruct 56–274； UniProt 1–219 Author chain M8； PDBConstruct 56–274； UniProt 1–219 Author chain M9； PDBConstruct 56–274； UniProt 1–219 Author chain MA； PDBConstruct 56–274； UniProt 1–219

Phycocyanin-associated rod linker protein

OrganismNot specified

UniProt Q7NM19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NM19_GLOVI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain N1； PDBConstruct 57–275； UniProt 1–219 Author chain N3； PDBConstruct 57–275； UniProt 1–219 Author chain N9； PDBConstruct 57–275； UniProt 1–219 Author chain NA； PDBConstruct 57–275； UniProt 1–219 Author chain Z4； PDBConstruct 57–275； UniProt 1–219 Author chain Z8； PDBConstruct 57–275； UniProt 1–219

Glr2806 protein

OrganismNot specified

UniProt Q7NGT2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NGT2_GLOVI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M2； PDBConstruct 1–729； UniProt 1–729 Author chain M6； PDBConstruct 1–729； UniProt 1–729

CpcD protein

OrganismNot specified

UniProt Q7NL59

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL59_GLOVI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N2； PDBConstruct 1–70； UniProt 1–70 Author chain N6； PDBConstruct 1–70； UniProt 1–70

Allophycocyanin alpha subunit

OrganismNot specified

UniProt Q7NL80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL80_GLOVI
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A5； PDBConstruct 1–161； UniProt 1–161 Author chain A7； PDBConstruct 1–161； UniProt 1–161 Author chain C5； PDBConstruct 1–161； UniProt 1–161 Author chain C7； PDBConstruct 1–161； UniProt 1–161 Author chain E5； PDBConstruct 1–161； UniProt 1–161 Author chain E7； PDBConstruct 1–161； UniProt 1–161 Author chain G5； PDBConstruct 1–161； UniProt 1–161 Author chain G7； PDBConstruct 1–161； UniProt 1–161 Author chain I5； PDBConstruct 1–161； UniProt 1–161 Author chain I7； PDBConstruct 1–161； UniProt 1–161 Author chain K5； PDBConstruct 1–161； UniProt 1–161 Author chain K7； PDBConstruct 1–161； UniProt 1–161 Author chain M5； PDBConstruct 1–161； UniProt 1–161 Author chain M7； PDBConstruct 1–161； UniProt 1–161 Author chain O5； PDBConstruct 1–161； UniProt 1–161 Author chain O7； PDBConstruct 1–161； UniProt 1–161 Author chain Q5； PDBConstruct 1–161； UniProt 1–161 Author chain Q7； PDBConstruct 1–161； UniProt 1–161 Author chain S5； PDBConstruct 1–161； UniProt 1–161 Author chain S7； PDBConstruct 1–161； UniProt 1–161 Author chain U5； PDBConstruct 1–161； UniProt 1–161 Author chain U7； PDBConstruct 1–161； UniProt 1–161 Author chain W5； PDBConstruct 1–161； UniProt 1–161 Author chain W7； PDBConstruct 1–161； UniProt 1–161 Author chain Y5； PDBConstruct 1–161； UniProt 1–161 Author chain Y7； PDBConstruct 1–161； UniProt 1–161 Author chain a5； PDBConstruct 1–161； UniProt 1–161 Author chain a7； PDBConstruct 1–161； UniProt 1–161 Author chain c5； PDBConstruct 1–161； UniProt 1–161 Author chain c7； PDBConstruct 1–161； UniProt 1–161 Author chain e5； PDBConstruct 1–161； UniProt 1–161 Author chain e7； PDBConstruct 1–161； UniProt 1–161 Author chain g7； PDBConstruct 1–161； UniProt 1–161 Author chain i7； PDBConstruct 1–161； UniProt 1–161 Author chain k7； PDBConstruct 1–161； UniProt 1–161 Author chain m7； PDBConstruct 1–161； UniProt 1–161 Author chain o7； PDBConstruct 1–161； UniProt 1–161 Author chain q7； PDBConstruct 1–161； UniProt 1–161 Author chain s7； PDBConstruct 1–161； UniProt 1–161 Author chain u7； PDBConstruct 1–161； UniProt 1–161

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt Q7NL78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobiliprotein ApcE × 2 （Q7NL81） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL78_GLOVI
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain i5； PDBConstruct 1–68； UniProt 2–69 Author chain w7； PDBConstruct 1–68； UniProt 2–69 Author chain x7； PDBConstruct 1–68； UniProt 2–69 Author chain y7； PDBConstruct 1–68； UniProt 2–69 Author chain z5； PDBConstruct 1–68； UniProt 2–69 Author chain z7； PDBConstruct 1–68； UniProt 2–69

Phycobiliprotein ApcE

OrganismNot specified

UniProt Q7NL81

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Glr1262 protein × 2 （Q7NL64） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL81_GLOVI
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain j5； PDBConstruct 1–1155； UniProt 1–1155 Author chain k5； PDBConstruct 1–1155； UniProt 1–1155

Glr1262 protein

OrganismNot specified

UniProt Q7NL64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 276	Allophycocyanin beta subunit × 42 （Q7NL79） Phycocyanin alpha chain × 84 （Q7M7F7） Phycocyanin beta chain × 84 （Q7M7C7） Phycocyanin-associated rod linker protein × 6 （Q7NGF2） Phycocyanin-associated rod linker protein × 6 （Q7NM19） Glr2806 protein × 2 （Q7NGT2） CpcD protein × 2 （Q7NL59） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） PHYCOCYANOBILIN × 336	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL64_GLOVI
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain a9； PDBConstruct 1–824； UniProt 1–824 Author chain aA； PDBConstruct 1–824； UniProt 1–824

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9k9w
Deposition date deposition_date	2024-10-28
Structure title title	structure of bundle-shaped PBS with short rod
Keywords keywords	phycobilisome, light-harvesting complex, photosynthesis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9k9w__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9k9w__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9k9w__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	133.70 Å
Total Rg	133.70 Å
Atom count	382772
Residues	48186
Excluded volume	6818600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9k9w__assembly_1__model_1`	276-meric （276）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Allophycocyanin beta subunit
Molecular weight formula_weight	17241.7 kDa
Source method src_method	nat
Copy count entity_count	42

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,Z,L5,N5,B5,D5,F5,H5,J5,d5,f5,P5,R5,T5,V5,X5,Z5,b5,P7,R7,B7,D7,F7,H7,J7,L7,N7,h7,j7,T7,V7,X7,Z7,b7,d7,f7,l7,n7,p7,r7,t7,v7
Atom count atom_count	382772

MQDAITAVINNYDVQGKYLDGAALDKLKAYFTTGAVRVRAAAVISSNATTIIKEAAAKALIYSDLTRPGGNMYTTRRYAACIRDMDYFLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIAATVGGIQAMKEVVGGLVGPDAAKEASIYFDYLSSGLS

Entity 2 Entity 2 polymer

Description description	Phycocyanin alpha chain
Molecular weight formula_weight	17679.9 kDa
Source method src_method	nat
Copy count entity_count	84

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;AA,CA,EA,GA,IA,KA,OA,QA,SA,UA,WA,YA,O1,Q1,S1,A1,G3,I3,K3,G2,I2,K2,A3,C3,E3,A4,C4,O3,Q3,S3,U3,W3,Y3,T4,V4,E4,G4,I4,K4,N4,P4,R4,X4,C1,K6,A6,C6,E6,G6,I6,E1,A8,C8,E8,T8,V8,X8,G8,I8,K8,N8,P8,R8,O9,Q9,A9,C9,E9,G9,I9,K9,S9,U9,W9,Y9,G1,I1,K1,U1,W1,Y1,A2,C2,E2 ;

MKTVITEVIASADSQGRFLNNTELQAANGRFQRATASMEAARALTSNADSLVKGAVQEVYNKFPYLTQPGQMGYGDTNQAKCARDISHYLRFITYSLVAGGTGPLDDYIVAGLREVNRTFNLSPSWYIEALKHIKGKVGSQLSGQPLTEANAYIDYCINALS

Entity 3 Entity 3 polymer

Description description	Phycocyanin beta chain
Molecular weight formula_weight	18479.0 kDa
Source method src_method	nat
Copy count entity_count	84

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;BA,DA,FA,HA,JA,LA,PA,RA,TA,VA,XA,ZA,P1,R1,H3,J3,H2,J2,L2,B3,D3,F3,Z3,B4,D4,L3,P3,R3,T3,V3,X3,B1,S4,U4,W4,F4,H4,J4,L4,O4,Q4,Y4,J6,L6,B6,D6,F6,H6,D1,B8,D8,U8,W8,F8,H8,J8,L8,O8,Q8,S8,F1,L9,P9,Y8,B9,D9,F9,H9,J9,R9,T9,V9,X9,Z9,H1,J1,L1,T1,V1,X1,Z1,B2,D2,F2 ;

MQDAFTKAIVAADLRGSFLSEQELNQLTNLVKESNKRLDAVNAITGNAAEIISDAAHKLFAEQTDLIRPGGNAYPNRRMAACLRDMEIILRYVSYALLAGDASVLEDRCLNGLKETYVALGTPTRSVARAVQLMKETAIGYVNSPSGVTRGDCSALVNEAATYFDKAAASIA

Entity 4 Entity 4 polymer

Description description	Phycocyanin-associated rod linker protein
Molecular weight formula_weight	30913.8 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	MA,M3,M4,M8,M9,M1

MNVLTTSSQRGGKLFKVTMTLSPALSHHPWPSLDTYEPSQNSYSVVVPLDRLLAEMTYIKNKGGRVLDISPADLEALGPPDISSVAIPLKVELWAKADVSDVQAAIVAAYKQIFGNTYVLESERLTSAESLLRNGSISVREFVRLLAKSELYKERFFFCTSNNRFTELNFKHFLGRAPYNQSEIAAHLDRYQTFGYDAEIDSYIDSDEYIQAFGENVVPYYRGFKSQSGQTVESFNRMFKLYRGDAGSDTNLNLQGQKRRVDPKNLLRSGRGIV

Entity 5 Entity 5 polymer

Description description	Phycocyanin-associated rod linker protein
Molecular weight formula_weight	31085.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	NA,N3,Z4,N9,Z8,N1

MSVLTGDNQQRGSKLFKITIALSPTLAHHPWPGLDTHEPSQSSYSTIVSLERLLPEMTRIKRNGGRILEITEGEASESRANFPAVMEPPVVELYPRAGEAEVQAVIAVAYKQVFGNIHVMESERIVSAESLLRNRSISVREFVRLLAKSDLYKESFFHCTSNNRFIELNFKHLLGRAPYNHSEIIEHLDRYQSQGYDAEIDSYIDSDEYVKTFGENVVPYHRGFKSQVGQQSVAAFERMIRLFGGDASSDTSLNRTGQKRLVDPKQLLRSGRGIV

Entity 6 Entity 6 polymer

Description description	Glr2806 protein
Molecular weight formula_weight	81544.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M2,M6

MSATTYDWRKVIDSIKIEDPVKPGDFANFLDMARGIESRTGVWSISYESLRTLGPPEGGMLRPAVGGTAEAAAQKQLGITAVAPASVVELRPNASEEDLQGVLRAVYRQVLGNTYVMESERPTQAESLLRNGSISVREFVRRIAKSDLYKERFFNKASNNRFIELNFKHLLGRAPYNHGEIQEHFGLYHKAGYDVEIDSYIDSDEYIETFGENIVPYFRGFKYQTNQSAGGFPRMVKLWGGDAGSDTDRGKNGQRTLVTTKDLIGPTKIFVPFVAPGRDADMVSGDYTRLAFGLSGEAAAQRQLGIASVAPAPICQLRPNASEEDLQGVLRAVYRQVLGNTYVMESERPTQAESLLRNGSISVREFVRRIAKSDLYKERFFNKASNNRFIELNFKHLLGRAPYNHGEIQEHFGLYHKAGYDVEIDSYIDSDEYIETFGENIVPYFRGFKYQTNQSAGGFPRMVKLWGGDAGSDTDRATGGQRTLVTTRELVKTLPLLTEIPAVPATRGFEQVLNQLKRPAPGGTGEAQGQKQLGITAVAPAPICQLRPNASEEDLQGVLRAVYRQVLGNTYVMESERPTQAESLLRNGSISVREFVRRIAKSDLYKERFFNKASNNRFIELNFKHLLGRAPYNHGEIQEHFGLYHKAGYDAEIDSYIDSDEYLLTFGEDVVPYFRGFKYQTNQSAGGFPRFTKLYGGDAGSDTDRGKNGQRTLVTTKDLVVSGQFSKPV

Entity 7 Entity 7 polymer

Description description	CpcD protein
Molecular weight formula_weight	7776.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N2,N6

MYNNVTANTEWGRKVFKITVAQFPDADGLDTDNLSQSNYFVTVPLARLLPEMQLIKNKGGKVLSVEPVVS

Entity 8 Entity 8 polymer

Description description	Allophycocyanin alpha subunit
Molecular weight formula_weight	17539.0 kDa
Source method src_method	nat
Copy count entity_count	40

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K5,M5,O5,A5,C5,E5,G5,I5,c5,e5,Q5,S5,U5,W5,Y5,a5,A7,O7,Q7,S7,C7,E7,G7,I7,K7,M7,g7,i7,k7,U7,W7,Y7,a7,c7,e7,m7,o7,q7,s7,u7

MSVLTKAIVNADAEARYLSPGELDRIKSFVASGERRLRIAQTLTEARERIVKQAGDQLFQIRPDVVSPGGNAYGEKMTALCLRDLDYYLRLVTYGIVAGDVTPIEEIGIIGVKEMYNSLQTPIPAVAEGVRAMKNVATSLLSGDDAAEAGFYFDYLVGAMQ

Entity 9 Entity 9 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7633.8 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z5,i5,z7,w7,x7,y7

SRYFKVTACIPSLKRVRTGRELQNTFFTKLVPYENWFTEQQRIQKAGGKVLSVKLFTGVQGANTGVGA

Entity 10 Entity 10 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	130002.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j5,k5

MSIRGTSGSTVARPRLFRTVMTETINGINAEDRYPNSGEVSQLDQFFGDGQRRIAIVAKLTENAEMIVSRAANRIFVGGSPMAYSERQKAKAKSPLANDEFGNEPIVEDRGGFLESLKSIFSTRGGGGRASADFAVPPDFEPINIARYGPERMQKSIRDLDWFLRYTTYAILAGDPSILEANCLGLREILEKSCSISATIVALLEMRKNAARLFKDEADSKLVSSYISVVIRALDADRSDAPADIVRPSSEDRPGLTLPYIYKLSADSLTTFKMTAIYGADGRPKVNLSSDEKERVVRAAYRQVFERDLKAYGQSVSEAESKVKNGEISVREFVRRLGKSELYRREFYQPFINSRVLELAFKHFLGRAPESRAEVQKYFSIISSPIVRGQSSMPSGGLYALIDALIDSEEYTSIFGEDTVPYLRNLGVEAQPSWNWGAAYDLYNYAAPRRKVPQFITLFADYTQPLPNQHPYGAGNDPLEIQFGAIFKNSTINPAERAAPIGKDVKRILIRNGSPTSNERGNPTGMSEGATTLGPKIFKLTQNVGFRSKGMVQNAGVVTVEGSVQALITAAYQQIFGRQLYQGQRLKVAEIKLENGETTVKEFVRALGRSEIFRKLYWEPFYVCKAIEYIHRRLLGRPTYDRVENNRYFDIASKKGFYGVVDAMLNSNEYQEVFGEDVLPYERYLTPAGLSLRKGRFGSSDVLTTPGGITPRGDAARMMDKIQELGTPINERSIPEMYVNQGVPALKRQRKVFKQSQATDRESFDALVTAAYVQVFDKDIASYIRSEFSALESRLRNRETSVKEFVRLLGFSALYRKQFHDRYPNTKVVEFAFKHFLGRAVKNQAELIKYHGLLGRKGIKALIGALVDGEEYGRLYGEDTVPSWQFPTLPAANYPNSVELYNRFTRQDDSLVVPSFKPIRSKMDIASMPLVQAALKEQQATKTALDMSRPMFLELGRSFKGADGQSVEVGVGTLRRQLEHIYRIAPDATRSEKDVAINAIYRQVLDVFAGIPPSYLRLSEAESKLKNNEISVREFVRRLGRSENYRKRFFEPYSSPKVVELLTKHFLGRAPISQQEISTYVQILGTKGLAAAVDAIVESPEYLTIFNEDIVPYRRYPTLPAGNYRASVRVNDEELISQSWSSLSPTYTGYQYVTR

Entity 11 Entity 11 polymer

Description description	Glr1262 protein
Molecular weight formula_weight	92127.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a9,aA

MSTVLDDQSKAYAPGSANGPTAGLEPFVRMSRMIRSGVPEDREEPDELWLSMVRDIFGRGYMDRLSQTRAIDYSAFVRPADQATADGAAQTKLGITAIAPDQGVELRPNFTEADVITVIRAAYKQLFGNTYILESERVIQAESLLRNGSISVREFIRILAKSDLYKERFFRCTSNNRFIELNLKHLLGRAPYNQGEIAEHLDRYCQSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQVGQSAAAFERMRALYSGDAGSDTDRNQNGQRTELTSGLADPAQPVRARTDYALTRVDIPGGNGAAGRLAALDESLGSWLDAARDLISQNDYSQKAIEVEPKRVAPYAQYLTPAVEATPDAAAQTKLGITAVAPDQAVELRPNFGEAEVQAVIRAAYKQIFGNTYILEADRVVIAESLLRNGSISVREFVRLLAKSDLYRDRFFRTASNNRFIELNFKHFLGRAPYSQAEIGEHFNRYHKSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQVGQAARGFDQMQQLFAGDAGSDTDRGIGAQPAAKLTFPLSRPLGVTSAYFPSSQGGAATSDGLEMFTRMARELTVTPVSARRTTSPTAPTAPAMPLAGYYSRPAPRATADGDAQTKLGITAVAPAQAVELRPNFGETELQAVIRATYKQLFGNTYILEADRVVQAESLLRNGSINVREFVRLLAKSELYKERFFHCTSNNRFIELTFKHLLGRAPYNQSEFVEHLDRYQKSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQTGQAAGVFERTLKLYGGDADSDTNRNRQGQLRQVDPQELLRSGRGIV

Entity 12 Entity 12 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	336

▶

Resolution resolution	2.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	389430

structure of bundle-shaped PBS with short rod

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycocyanin-associated rod linker protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycocyanin-associated rod linker protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Glr2806 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CpcD protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer