SAXSdb — 9v7j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobiliprotein ApcE

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Allophycocyanin alpha subunit × 40 （Q7NL80） Allophycocyanin beta subunit × 40 （Q7NL79） Phycobilisome core component × 2 （Q7NJA2） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL81_GLOVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1155； UniProt 1–1155 Author chain C； PDBConstruct 1–1155； UniProt 1–1155

Allophycocyanin alpha subunit

OrganismNot specified

UniProt Q7NL80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Phycobiliprotein ApcE × 2 （Q7NL81） Allophycocyanin beta subunit × 40 （Q7NL79） Phycobilisome core component × 2 （Q7NJA2） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL80_GLOVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–161； UniProt 1–161 Author chain 3； PDBConstruct 1–161； UniProt 1–161 Author chain 5； PDBConstruct 1–161； UniProt 1–161 Author chain 7； PDBConstruct 1–161； UniProt 1–161 Author chain 9； PDBConstruct 1–161； UniProt 1–161 Author chain AA； PDBConstruct 1–161； UniProt 1–161 Author chain AC； PDBConstruct 1–161； UniProt 1–161 Author chain AE； PDBConstruct 1–161； UniProt 1–161 Author chain AG； PDBConstruct 1–161； UniProt 1–161 Author chain AI； PDBConstruct 1–161； UniProt 1–161 Author chain AK； PDBConstruct 1–161； UniProt 1–161 Author chain AM； PDBConstruct 1–161； UniProt 1–161 Author chain AO； PDBConstruct 1–161； UniProt 1–161 Author chain AQ； PDBConstruct 1–161； UniProt 1–161 Author chain AS； PDBConstruct 1–161； UniProt 1–161 Author chain AU； PDBConstruct 1–161； UniProt 1–161 Author chain AW； PDBConstruct 1–161； UniProt 1–161 Author chain E； PDBConstruct 1–161； UniProt 1–161 Author chain G； PDBConstruct 1–161； UniProt 1–161 Author chain I； PDBConstruct 1–161； UniProt 1–161 Author chain K； PDBConstruct 1–161； UniProt 1–161 Author chain M； PDBConstruct 1–161； UniProt 1–161 Author chain O； PDBConstruct 1–161； UniProt 1–161 Author chain Q； PDBConstruct 1–161； UniProt 1–161 Author chain S； PDBConstruct 1–161； UniProt 1–161 Author chain U； PDBConstruct 1–161； UniProt 1–161 Author chain W； PDBConstruct 1–161； UniProt 1–161 Author chain Y； PDBConstruct 1–161； UniProt 1–161 Author chain a； PDBConstruct 1–161； UniProt 1–161 Author chain c； PDBConstruct 1–161； UniProt 1–161 Author chain e； PDBConstruct 1–161； UniProt 1–161 Author chain g； PDBConstruct 1–161； UniProt 1–161 Author chain i； PDBConstruct 1–161； UniProt 1–161 Author chain k； PDBConstruct 1–161； UniProt 1–161 Author chain m； PDBConstruct 1–161； UniProt 1–161 Author chain o； PDBConstruct 1–161； UniProt 1–161 Author chain r； PDBConstruct 1–161； UniProt 1–161 Author chain t； PDBConstruct 1–161； UniProt 1–161 Author chain w； PDBConstruct 1–161； UniProt 1–161 Author chain y； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin beta subunit

OrganismNot specified

UniProt Q7NL79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Phycobiliprotein ApcE × 2 （Q7NL81） Allophycocyanin alpha subunit × 40 （Q7NL80） Phycobilisome core component × 2 （Q7NJA2） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL79_GLOVI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 0； PDBConstruct 1–161； UniProt 1–161 Author chain 2； PDBConstruct 1–161； UniProt 1–161 Author chain 4； PDBConstruct 1–161； UniProt 1–161 Author chain 6； PDBConstruct 1–161； UniProt 1–161 Author chain 8； PDBConstruct 1–161； UniProt 1–161 Author chain AB； PDBConstruct 1–161； UniProt 1–161 Author chain AD； PDBConstruct 1–161； UniProt 1–161 Author chain AF； PDBConstruct 1–161； UniProt 1–161 Author chain AH； PDBConstruct 1–161； UniProt 1–161 Author chain AJ； PDBConstruct 1–161； UniProt 1–161 Author chain AL； PDBConstruct 1–161； UniProt 1–161 Author chain AN； PDBConstruct 1–161； UniProt 1–161 Author chain AP； PDBConstruct 1–161； UniProt 1–161 Author chain AR； PDBConstruct 1–161； UniProt 1–161 Author chain AT； PDBConstruct 1–161； UniProt 1–161 Author chain AV； PDBConstruct 1–161； UniProt 1–161 Author chain AX； PDBConstruct 1–161； UniProt 1–161 Author chain F； PDBConstruct 1–161； UniProt 1–161 Author chain H； PDBConstruct 1–161； UniProt 1–161 Author chain J； PDBConstruct 1–161； UniProt 1–161 Author chain L； PDBConstruct 1–161； UniProt 1–161 Author chain N； PDBConstruct 1–161； UniProt 1–161 Author chain P； PDBConstruct 1–161； UniProt 1–161 Author chain R； PDBConstruct 1–161； UniProt 1–161 Author chain T； PDBConstruct 1–161； UniProt 1–161 Author chain V； PDBConstruct 1–161； UniProt 1–161 Author chain X； PDBConstruct 1–161； UniProt 1–161 Author chain Z； PDBConstruct 1–161； UniProt 1–161 Author chain b； PDBConstruct 1–161； UniProt 1–161 Author chain d； PDBConstruct 1–161； UniProt 1–161 Author chain f； PDBConstruct 1–161； UniProt 1–161 Author chain h； PDBConstruct 1–161； UniProt 1–161 Author chain j； PDBConstruct 1–161； UniProt 1–161 Author chain l； PDBConstruct 1–161； UniProt 1–161 Author chain n； PDBConstruct 1–161； UniProt 1–161 Author chain p； PDBConstruct 1–161； UniProt 1–161 Author chain q； PDBConstruct 1–161； UniProt 1–161 Author chain v； PDBConstruct 1–161； UniProt 1–161 Author chain x； PDBConstruct 1–161； UniProt 1–161 Author chain z； PDBConstruct 1–161； UniProt 1–161

Phycobilisome core component

OrganismNot specified

UniProt Q7NJA2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Phycobiliprotein ApcE × 2 （Q7NL81） Allophycocyanin alpha subunit × 40 （Q7NL80） Allophycocyanin beta subunit × 40 （Q7NL79） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q7NL78） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NJA2_GLOVI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain s； PDBConstruct 1–161； UniProt 1–161 Author chain u； PDBConstruct 1–161； UniProt 1–161

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt Q7NL78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Phycobiliprotein ApcE × 2 （Q7NL81） Allophycocyanin alpha subunit × 40 （Q7NL80） Allophycocyanin beta subunit × 40 （Q7NL79） Phycobilisome core component × 2 （Q7NJA2） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL78_GLOVI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AY； PDBConstruct 1–69； UniProt 1–69 Author chain AZ； PDBConstruct 1–69； UniProt 1–69 Author chain Aa； PDBConstruct 1–69； UniProt 1–69 Author chain Ab； PDBConstruct 1–69； UniProt 1–69 Author chain Ac； PDBConstruct 1–69； UniProt 1–69 Author chain Ad； PDBConstruct 1–69； UniProt 1–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9v7j
Deposition date deposition_date	2025-05-28
Structure title title	Phycobilisome core from Gloeobacter violaceus PCC 7421
Keywords keywords	Phycobilisome, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9v7j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9v7j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9v7j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	86.29 Å
Rg (electron density)	86.05 Å
Total Rg	86.11 Å
Atom count	123484
Residues	15644
Excluded volume	2213100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9v7j__assembly_1__model_1`	90-meric （90）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	130002.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	123484

MSIRGTSGSTVARPRLFRTVMTETINGINAEDRYPNSGEVSQLDQFFGDGQRRIAIVAKLTENAEMIVSRAANRIFVGGSPMAYSERQKAKAKSPLANDEFGNEPIVEDRGGFLESLKSIFSTRGGGGRASADFAVPPDFEPINIARYGPERMQKSIRDLDWFLRYTTYAILAGDPSILEANCLGLREILEKSCSISATIVALLEMRKNAARLFKDEADSKLVSSYISVVIRALDADRSDAPADIVRPSSEDRPGLTLPYIYKLSADSLTTFKMTAIYGADGRPKVNLSSDEKERVVRAAYRQVFERDLKAYGQSVSEAESKVKNGEISVREFVRRLGKSELYRREFYQPFINSRVLELAFKHFLGRAPESRAEVQKYFSIISSPIVRGQSSMPSGGLYALIDALIDSEEYTSIFGEDTVPYLRNLGVEAQPSWNWGAAYDLYNYAAPRRKVPQFITLFADYTQPLPNQHPYGAGNDPLEIQFGAIFKNSTINPAERAAPIGKDVKRILIRNGSPTSNERGNPTGMSEGATTLGPKIFKLTQNVGFRSKGMVQNAGVVTVEGSVQALITAAYQQIFGRQLYQGQRLKVAEIKLENGETTVKEFVRALGRSEIFRKLYWEPFYVCKAIEYIHRRLLGRPTYDRVENNRYFDIASKKGFYGVVDAMLNSNEYQEVFGEDVLPYERYLTPAGLSLRKGRFGSSDVLTTPGGITPRGDAARMMDKIQELGTPINERSIPEMYVNQGVPALKRQRKVFKQSQATDRESFDALVTAAYVQVFDKDIASYIRSEFSALESRLRNRETSVKEFVRLLGFSALYRKQFHDRYPNTKVVEFAFKHFLGRAVKNQAELIKYHGLLGRKGIKALIGALVDGEEYGRLYGEDTVPSWQFPTLPAANYPNSVELYNRFTRQDDSLVVPSFKPIRSKMDIASMPLVQAALKEQQATKTALDMSRPMFLELGRSFKGADGQSVEVGVGTLRRQLEHIYRIAPDATRSEKDVAINAIYRQVLDVFAGIPPSYLRLSEAESKLKNNEISVREFVRRLGRSENYRKRFFEPYSSPKVVELLTKHFLGRAPISQQEISTYVQILGTKGLAAAVDAIVESPEYLTIFNEDIVPYRRYPTLPAGNYRASVRVNDEELISQSWSSLSPTYTGYQYVTR

Entity 2 Entity 2 polymer

Description description	Allophycocyanin alpha subunit
Molecular weight formula_weight	17555.1 kDa
Source method src_method	nat
Copy count entity_count	40

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,O,E,G,I,K,Q,S,U,W,Y,a,c,e,g,i,k,m,o,r,t,w,y,1,3,5,7,9,AA,AC,AE,AG,AI,AK,AM,AO,AQ,AS,AU,AW

MSVLTKAIVNADAEARYLSPGELDRIKSFVASGERRLRIAQTLTEARERIVKQAGDQLFQKRPDVVSPGGNAYGEKMTALCLRDLDYYLRLVTYGIVAGDVTPIEEIGIIGVKEMYNSLQTPIPAVAEGVRAMKNVATSLLSGDDAAEAGFYFDYLVGAMQ

Entity 3 Entity 3 polymer

Description description	Allophycocyanin beta subunit
Molecular weight formula_weight	17241.7 kDa
Source method src_method	nat
Copy count entity_count	40

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,P,F,H,J,L,R,T,V,X,Z,b,d,f,h,j,l,n,p,q,v,x,z,2,4,6,8,0,AB,AD,AF,AH,AJ,AL,AN,AP,AR,AT,AV,AX

MQDAITAVINNYDVQGKYLDGAALDKLKAYFTTGAVRVRAAAVISSNATTIIKEAAAKALIYSDLTRPGGNMYTTRRYAACIRDMDYFLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIAATVGGIQAMKEVVGGLVGPDAAKEASIYFDYLSSGLS

Entity 4 Entity 4 polymer

Description description	Phycobilisome core component
Molecular weight formula_weight	17452.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s,u

MKDAISTVIAKYDSQGKYFDNAAVDQLKAYFATGELRVRSAAAISANAQSIIKEATAKALLYSSLTRTGGNMYYARRFAACIRDMEYFLRYATFAMVAGDTSLLDEYVLNGLKETYTSLGVPIDATVKGINALREVVASVVGPEAAGEASKYFDHLAKGLQ

Entity 5 Entity 5 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7765.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY,AZ,Aa,Ab,Ac,Ad

MSRYFKVTACIPSLKRVRTGRELQNTFFTKLVPYENWFTEQQRIQKAGGKVLSVKLFTGVQGANTGVGA

Entity 6 Entity 6 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	84

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.85 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	746972

Phycobilisome core from Gloeobacter violaceus PCC 7421

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Allophycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Allophycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome core component

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9v7j__assembly_1__model_1

9v7j__assembly_1__model_1 | I(q)

9v7j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Phycobilisome core from Gloeobacter violaceus PCC 7421

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome core component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9v7j__assembly_1__model_1

9v7j__assembly_1__model_1 | I(q)

9v7j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)