SAXSdb — 9kee

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lactoylglutathione lyase

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–184 Chain B； UniProt 1–184	Not recorded	ZN ZINC ION × 2 A1L5R 1-(4-hydroxyphenyl)-3-[2-methoxy-3,4-bis(oxidanyl)phenyl]prop-2-en-1-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.2 M Sodium chloride, 0.1 M Bis-Tris, 25%(w/v) PEG 3350	Resolution 2.08 Å R-free 0.234

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9KEE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BH5 HUMAN GLYOXALASE I Q33E, E172Q DOUBLE MUTANT Deposited 1998-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–183（183 aa） Chain B 1–183（183 aa）	Mutation：Q33E, E172Q Mutation：Q33E, E172Q	ZN ZINC ION × 2 GTX S-HEXYLGLUTATHIONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；PROTEIN WAS CRYSTALLISED FROM PEG 2000 MONOMETHLY ETHER 50 MM MES PH 5.8, 0.1M NACL	Resolution 2.20 Å R-free 0.250
1BH5 HUMAN GLYOXALASE I Q33E, E172Q DOUBLE MUTANT Deposited 1998-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–183（183 aa） Chain D 1–183（183 aa）	Mutation：Q33E, E172Q Mutation：Q33E, E172Q	ZN ZINC ION × 2 GTX S-HEXYLGLUTATHIONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；PROTEIN WAS CRYSTALLISED FROM PEG 2000 MONOMETHLY ETHER 50 MM MES PH 5.8, 0.1M NACL	Resolution 2.20 Å R-free 0.250
1FRO HUMAN GLYOXALASE I WITH BENZYL-GLUTATHIONE INHIBITOR Deposited 1997-02-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–184（183 aa） Chain B 2–184（183 aa）	Not recorded	ZN ZINC ION × 2 GSB S-BENZYL-GLUTATHIONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；pH 5.8	Resolution 2.20 Å R-free 0.234
1FRO HUMAN GLYOXALASE I WITH BENZYL-GLUTATHIONE INHIBITOR Deposited 1997-02-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 2–184（183 aa） Chain D 2–184（183 aa）	Not recorded	ZN ZINC ION × 2 GSB S-BENZYL-GLUTATHIONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；pH 5.8	Resolution 2.20 Å R-free 0.234
1QIN HUMAN GLYOXALASE I COMPLEXED WITH S-(N-HYDROXY-N-P-IODOPHENYLCARBAMOYL) GLUTATHIONE Deposited 1999-06-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–183（183 aa） Chain B 1–183（183 aa）	Not recorded	ZN ZINC ION × 2 GIP S-(N-HYDROXY-N-IODOPHENYLCARBAMOYL)GLUTATHIONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；PROTEIN WAS CRYSTALLISED BY EQILLABRATION AGAINST PEG 2000 MONOMETHLY ETHER, 50 MM MES PH 5.8, 0.1M NACL. HIPC-GSH WAS PRESENT IN THE PROTEIN SOLUTION	Resolution 2.00 Å R-free 0.210
1QIP HUMAN GLYOXALASE I COMPLEXED WITH S-P-NITROBENZYLOXYCARBONYLGLUTATHIONE Deposited 1999-06-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–183（183 aa） Chain B 1–183（183 aa）	Not recorded	ZN ZINC ION × 2 GNB S-P-NITROBENZYLOXYCARBONYLGLUTATHIONE × 2 BME BETA-MERCAPTOETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；PROTEIN WAS CRYSTALLISED BY EQILLABRATION AGAINST PEG 2000 MONOMETHLY ETHER, 50 MM MES PH 5.8, 0.1M NACL THEN SOAKED IN 10MM NBC-GSH	Resolution 1.72 Å R-free 0.210
1QIP HUMAN GLYOXALASE I COMPLEXED WITH S-P-NITROBENZYLOXYCARBONYLGLUTATHIONE Deposited 1999-06-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–183（183 aa） Chain D 1–183（183 aa）	Not recorded	ZN ZINC ION × 2 GNB S-P-NITROBENZYLOXYCARBONYLGLUTATHIONE × 2 BME BETA-MERCAPTOETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；PROTEIN WAS CRYSTALLISED BY EQILLABRATION AGAINST PEG 2000 MONOMETHLY ETHER, 50 MM MES PH 5.8, 0.1M NACL THEN SOAKED IN 10MM NBC-GSH	Resolution 1.72 Å R-free 0.210
3VW9 Human Glyoxalase I with an N-hydroxypyridone inhibitor Deposited 2012-08-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 HPJ 1-hydroxy-6-[1-(3-methoxypropyl)-1H-pyrrolo[2,3-b]pyridin-5-yl]-4-phenylpyridin-2(1H)-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；25%(w/v) PEG 2000 MME, 10%(v/v) Glycerol, 0.1M Na-HEPES (pH 7.0), vapor diffusion, hanging drop, temperature 293K	Resolution 1.47 Å R-free 0.193
3W0T Human Glyoxalase I with an N-hydroxypyridone derivative inhibitor Deposited 2012-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 HPU N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；33% (w/v) PEG 2000 MME, 0.1M Na-HEPES (pH 7.0), vapor diffusion, hanging drop, temperature 293K	Resolution 1.35 Å R-free 0.197
3W0T Human Glyoxalase I with an N-hydroxypyridone derivative inhibitor Deposited 2012-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–184（184 aa） Chain D 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 HPU N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；33% (w/v) PEG 2000 MME, 0.1M Na-HEPES (pH 7.0), vapor diffusion, hanging drop, temperature 293K	Resolution 1.35 Å R-free 0.197
3W0U human Glyoxalase I with an N-hydroxypyridone inhibitor Deposited 2012-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 HPW N-[3-(1-Hydroxy-6-oxo-4-phenyl-1,6-dihydro-pyridin-2-yl)-5-methanesulfonylamino-phenyl]-methanesulfonamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；25% (w/v) PEG 2000 MME, 10%(v/v) Glycerol, 0.1M Na-HEPES (pH 7.0), vapor diffusion, hanging drop, temperature 293K	Resolution 1.70 Å R-free 0.242
7WSZ human glyoxalase I (with C-ter His tag) in glycerol-bound form Deposited 2022-02-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 GOL GLYCEROL × 4 BO3 BORIC ACID × 3 IMD IMIDAZOLE × 1 BME BETA-MERCAPTOETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M MIB (sodium malonate, imidazole, and boric acid), 25% PEG1500	Resolution 1.52 Å R-free 0.187
7WT0 human glyoxalase I (with C-ter His tag) in complex with TLSC702 Deposited 2022-02-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 5ZO (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M MgCl2, 0.1 M Bis-Tris, 25% PEG3350	Resolution 2.00 Å R-free 0.222
7WT1 human glyoxalase I (with C-ter His tag) in inhibitor-free form Deposited 2022-02-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M NaCl, 0.1 M MES-NaOH, 25% PEG3350	Resolution 1.85 Å R-free 0.230
7WT2 human glyoxalase I in complex with TLSC702 Deposited 2022-02-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 5ZO (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M NaCl, 0.1 M Bis-Tris, 25% PEG3350	Resolution 2.00 Å R-free 0.228
9KEG human glyoxalase I (with C-ter His tag) in complex with licochalcone B, form 2 Deposited 2024-11-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	A1L5R 1-(4-hydroxyphenyl)-3-[2-methoxy-3,4-bis(oxidanyl)phenyl]prop-2-en-1-one × 2 PG4 TETRAETHYLENE GLYCOL × 2 BME BETA-MERCAPTOETHANOL × 3 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；293 K；0.2 M Sodium chloride, 0.1 M MES, 25%(w/v) PEG 3350	Resolution 1.80 Å R-free 0.239
9KEH human glyoxalase I (with C-ter His tag) in complex with licochalcone B and GSH, form 3 Deposited 2024-11-05	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 A1L5R 1-(4-hydroxyphenyl)-3-[2-methoxy-3,4-bis(oxidanyl)phenyl]prop-2-en-1-one × 2 PG4 TETRAETHYLENE GLYCOL × 2 GSH Glutathione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.2 M Sodium chloride, 0.1 M Bis-Tris, 25%(w/v) PEG 3350	Resolution 1.72 Å R-free 0.193
9KEI human glyoxalase I (with C-ter His tag) in complex with licochalcone B, form 4 Deposited 2024-11-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	A1L5R 1-(4-hydroxyphenyl)-3-[2-methoxy-3,4-bis(oxidanyl)phenyl]prop-2-en-1-one × 2 PGE TRIETHYLENE GLYCOL × 2 ZN ZINC ION × 2 BME BETA-MERCAPTOETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；293 K；0.2 M Sodium chloride, 0.1 M MES, 25%(w/v) PEG 3350	Resolution 1.81 Å R-free 0.238
9KEK human glyoxalase I (with C-ter His tag) in complex with piceatannol Deposited 2024-11-05	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Chain B 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 PIT PICEATANNOL × 2 PG4 TETRAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.2 M Sodium chloride, 0.1 M Bis-Tris, 25%(w/v) PEG 3350	Resolution 2.11 Å R-free 0.233
9KEK human glyoxalase I (with C-ter His tag) in complex with piceatannol Deposited 2024-11-05	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–184（184 aa） Chain D 1–184（184 aa）	Not recorded	ZN ZINC ION × 2 PIT PICEATANNOL × 1 PG4 TETRAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.2 M Sodium chloride, 0.1 M Bis-Tris, 25%(w/v) PEG 3350	Resolution 2.11 Å R-free 0.233

15 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LGUL_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–184； UniProt 1–184 Author chain B； PDBConstruct 1–184； UniProt 1–184

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9kee
Deposition date deposition_date	2024-11-04
最后修订 last_revision	2025-11-12
Structure title title	human glyoxalase I (with C-ter His tag) in complex with licochalcone B, form 1
Keywords keywords	glyoxalase i, zinc metalloenzyme, lyase; LYASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	20.84 Å
Radius of gyration Rg (electron density) rg_electron	19.59 Å
Forward intensity I(0) i0	26952400.00
Molecular weight molecular_weight	40386.0 kDa
Excluded volume excluded_volume	50696 Å³
Envelope volume envelope_volume	57692 Å³
Hydration-shell volume shell_volume	23682 Å³
Envelope diameter envelope_diameter	62.5 Å
Shell Rg shell_rg	26.88 Å
Envelope Rg envelope_rg	19.90 Å
Shape Rg shape_rg	19.59 Å
Total Rg total_rg	20.50 Å
Total atoms total_atoms	5603
Residues n_residues	351
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	62.5 Å
Rg (real space) rg_real	20.67 Å
Rg uncertainty (real space) rg_real_error	0.23 Å
I(0) (real space) i0_real	2.6950e+07
I(0) uncertainty (real space) i0_real_error	3.0780e+05
Rg (reciprocal space) rg_reciprocal	20.71 Å
I(0) (reciprocal space) i0_reciprocal	26950000.0000
Solution quality estimate total_estimate	0.7430
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	28.1 Å
Skewness Skewness skewness	0.071
Kurtosis Kurtosis kurtosis	-0.490
Angular range angular_range	— – 0.3800 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6409000.0000
Real-space data points n_real_points	70
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.928; Stabil: 1.000; Sysdev: 0.301; Positv: 1.000; Valcen: 0.973; Smooth: 0.997

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Lactoylglutathione lyase
Molecular weight formula_weight	21874.9 kDa
EC 编号 ec_number	4.4.1.5
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5740

MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	1-(4-hydroxyphenyl)-3-[2-methoxy-3,4-bis(oxidanyl)phenyl]prop-2-en-1-one
Molecular weight formula_weight	286.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	128

▶

8. Citations (1)

▶

Unit-cell length a length_a	69.258 Å
Unit-cell length b length_b	66.149 Å
Unit-cell length c length_c	42.068 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	99.69 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.080 Å
Low-resolution limit resolution_low	19.875 Å
R factor r_factor	—
R_work r_work	0.1663
R_free r_free	0.2338

fit	/app/data/saxs_computation/ke/9kee/9kee.fit
pddf	/app/data/pr_computation/ke/9kee/9kee.pr.out
profile	/app/data/saxs_computation/ke/9kee/9kee.dat

human glyoxalase I (with C-ter His tag) in complex with licochalcone B, form 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lactoylglutathione lyase

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction