SAXSdb — 9kld

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SKP1-like protein 1A

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Hyposensitive to light 7 × 1 （A0A0M3PNA2） F-box protein × 1 （T1RVG4） Protein SUPPRESSOR OF MAX2 1 × 1 （Q9FHH2） (3E,3aR,8bS)-3-({[(2R)-4-methyl-5-oxo-2,5-dihydrofuran-2-yl]oxy}methylidene)-3,3a,4,8b-tetrahydro-2H-indeno[1,2-b]furan-2-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SKP1A_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–160； UniProt 1–160

Hyposensitive to light 7

Striga hermonthica

UniProt A0A0M3PNA2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	SKP1-like protein 1A × 1 （Q39255） F-box protein × 1 （T1RVG4） Protein SUPPRESSOR OF MAX2 1 × 1 （Q9FHH2） (3E,3aR,8bS)-3-({[(2R)-4-methyl-5-oxo-2,5-dihydrofuran-2-yl]oxy}methylidene)-3,3a,4,8b-tetrahydro-2H-indeno[1,2-b]furan-2-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3PNA2_STRHE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 30–300； UniProt 1–271

F-box protein

Striga hermonthica

UniProt T1RVG4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	SKP1-like protein 1A × 1 （Q39255） Hyposensitive to light 7 × 1 （A0A0M3PNA2） Protein SUPPRESSOR OF MAX2 1 × 1 （Q9FHH2） (3E,3aR,8bS)-3-({[(2R)-4-methyl-5-oxo-2,5-dihydrofuran-2-yl]oxy}methylidene)-3,3a,4,8b-tetrahydro-2H-indeno[1,2-b]furan-2-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T1RVG4_STRHE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 39–765； UniProt 2–728

Protein SUPPRESSOR OF MAX2 1

Arabidopsis thaliana

UniProt Q9FHH2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	SKP1-like protein 1A × 1 （Q39255） Hyposensitive to light 7 × 1 （A0A0M3PNA2） F-box protein × 1 （T1RVG4） (3E,3aR,8bS)-3-({[(2R)-4-methyl-5-oxo-2,5-dihydrofuran-2-yl]oxy}methylidene)-3,3a,4,8b-tetrahydro-2H-indeno[1,2-b]furan-2-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMAX1_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 30–1019； UniProt 1–990

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9kld
Deposition date deposition_date	2024-11-14
Structure title title	Strigolactone-induced ASK1-MAX2-HTL7-SMAX1 complex (Class 2) with covalently bound D-ring
Keywords keywords	Strigolactone, SCF, Ubiquitination, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9kld__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9kld__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9kld__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.60 Å
Rg (electron density)	34.25 Å
Total Rg	34.80 Å
Atom count	9594
Residues	1227
Excluded volume	171400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9kld__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	SKP1-like protein 1A
Molecular weight formula_weight	17876.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	9594

MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Hyposensitive to light 7
Molecular weight formula_weight	33472.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MKHHHHHHHGAAGTSLYKKAGENLYFQGSMSSIGLAHNVTILGSGETTVVLGHGYGTDQSVWKLLVPYLVDDYKVLLYDHMGAGTTNPDYFDFDRYSSLEGYSYDLIAILEEFQVSKCIYVGHSMSSMAAAVASIFRPDLFHKLVMISPTPRLINTEEYYGGFEQKVMDETLRSLDENFKSLSLGTAPLLLACDLESAAMQEYCRTLFNMRPDIACCITRMICGLDLRPYLGHVTVPCHIIQSSNDIMVPVAVGEYLRKNLGGPSVVEVMPTEGHLPHLSMPEVTIPVVLRHIRQDITDH

Source Source

Source organism organism	Striga hermonthica
NCBI taxonomy ID ncbi_taxonomy_id	68872
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	F-box protein
Molecular weight formula_weight	85626.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MHHHHHHHHHSSGWSHPQFEKGGGSGGGSLEVLFQGPLTPKTNYIPFPSPIHQTPFQTDLAPMAAAAAAATTALNDLPDVILSNIMAGVSDVRSRNSASLVCHKWYLLERATRSALTLRGNIRDLFMLPTCFQSTSHLDLSLISPWGHPLTSAADPDSALIGHLLRHAFPSVTSLAIYARDPSTIHIVVPQWPDLERLKLVRWHQRPQTDAAGDELKLLISECGTLKSLDLSSFYCWTDDVPAALGSCPTFAANLKSLNLLNSSFSEGFKSDEIKAITKACPNLREFRASCMFDPRYIGHAGDEALVSISVNCPKLEILHLADTNALSSARSDFDPDEREGLGQEEAKINAATLIEVFSGLPLLEELALDLCNNVRDSGPALEVLNSKCPKLKSVKLGQFHGISLPVESKLDGIALCQGLESLSIRNVDDLTDMGLIAIGRGCYRLAKFEVYGCKKITVRGMRTMASLLRKTLVDVKIAACKKLGAVQSLKALEPIQDRVERLHIDCDWDCPDEEEPSDYFDSAAEYNECDDEMYSVRKRARYTYDLNSSSSGLDVNVEGYDEDKTWARLRYVSLWIFVGQLLTPLVAAGLNDCPELEEISIKVEGDCRVLSRPTVREFGLTTLLNYPKLSRMHLDCGDINGYAHTAPSGQMDLSLWERFYLIGVGHLGLTELNYWPPQDRDVNQRSLSLPAAGLLQECNRLRKLFIHGTAHEHFMMFFLRIEGLRDVQLRADYYPAPENDMSTEMRADSCSRFEVALNRRQISDSSGSSG

Source Source

Source organism organism	Striga hermonthica
NCBI taxonomy ID ncbi_taxonomy_id	68872
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Protein SUPPRESSOR OF MAX2 1
Molecular weight formula_weight	113453.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MKHHHHHHHGAAGTSLYKKAGENLYFQGSMRAGLSTIQQTLTPEAATVLNQSIAEAARRNHGQTTPLHVAATLLASPAGFLRRACIRSHPNSSHPLQCRALELCFSVALERLPTATTTPGNDPPISNALMAALKRAQAHQRRGCPEQQQQPLLAVKVELEQLIISILDDPSVSRVMREASFSSPAVKATIEQSLNNSVTPTPIPSVSSVGLNFRPGGGGPMTRNSYLNPRLQQNASSVQSGVSKNDDVERVMDILGRAKKKNPVLVGDSEPGRVIREILKKIEVGEVGNLAVKNSKVVSLEEISSDKALRIKELDGLLQTRLKNSDPIGGGGVILDLGDLKWLVEQPSSTQPPATVAVEIGRTAVVELRRLLEKFEGRLWFIGTATCETYLRCQVYHPSVETDWDLQAVSVAAKAPASGVFPRLANNLESFTPLKSFVPANRTLKCCPQCLQSYERELAEIDSVSSPEVKSEVAQPKQLPQWLLKAKPVDRLPQAKIEEVQKKWNDACVRLHPSFHNKNERIVPIPVPITLTTSPYSPNMLLRQPLQPKLQPNRELRERVHLKPMSPLVAEQAKKKSPPGSPVQTDLVLGRAEDSEKAGDVQVRDFLGCISSESVQNNNNISVLQKENLGNSLDIDLFKKLLKGMTEKVWWQNDAAAAVAATVSQCKLGNGKRRGVLSKGDVWLLFSGPDRVGKRKMVSALSSLVYGTNPIMIQLGSRQDAGDGNSSFRGKTALDKIAETVKRSPFSVILLEDIDEADMLVRGSIKQAMDRGRIRDSHGREISLGNVIFVMTASWHFAGTKTSFLDNEAKLRDLASESWRLRLCMREKFGKRRASWLCSDEERLTKPKKEHGSGLSFDLNQAADTDDGSHNTSDLTTDNDQDEQGFSGKLSLQCVPFAFHDMVSRVDDAVAFRAVDFAAVRRRITETLSERFETIIGESLSVEVEEEALQRILSGVWLGQTELEEWIEKAIVPVLSQLKARVSSSGTYGDCTVARLELDEDSGERNAGDLLPTTITLAVGSGSWSHPQFEK

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	(3E,3aR,8bS)-3-({[(2R)-4-methyl-5-oxo-2,5-dihydrofuran-2-yl]oxy}methylidene)-3,3a,4,8b-tetrahydro-2H-indeno[1,2-b]furan-2-one
Molecular weight formula_weight	298.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	80483

Strigolactone-induced ASK1-MAX2-HTL7-SMAX1 complex (Class 2) with covalently bound D-ring

1. Protein Identity and Related Structures Protein Identity & Related Structures

SKP1-like protein 1A

State in the Current Structure

Other States of the Same Protein in the Database

Hyposensitive to light 7

State in the Current Structure

Other States of the Same Protein in the Database

F-box protein

State in the Current Structure

Other States of the Same Protein in the Database

Protein SUPPRESSOR OF MAX2 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9kld__assembly_1__model_1

9kld__assembly_1__model_1 | I(q)

9kld__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)

Strigolactone-induced ASK1-MAX2-HTL7-SMAX1 complex (Class 2) with covalently bound D-ring

1. Protein Identity and Related Structures Protein Identity & Related Structures

SKP1-like protein 1A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hyposensitive to light 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-box protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein SUPPRESSOR OF MAX2 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9kld__assembly_1__model_1

9kld__assembly_1__model_1 | I(q)

9kld__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)