SAXSdb — 9lii

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA topoisomerase medium subunit

Enterobacteria phage T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	DNA topoisomerase large subunit,DNA topoisomerase small subunit × 2 （P09176,P23992）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOP5_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–442； UniProt 1–442 Author chain D； PDBConstruct 1–442； UniProt 1–442

DNA topoisomerase large subunit,DNA topoisomerase small subunit

Enterobacteria phage T4

UniProt P09176

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	DNA topoisomerase medium subunit × 2 （P07065）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOPL_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–516； UniProt 1–516 Author chain B； PDBConstruct 1–516； UniProt 1–516

DNA topoisomerase large subunit,DNA topoisomerase small subunit

Enterobacteria phage T4

UniProt P23992

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	DNA topoisomerase medium subunit × 2 （P07065）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOPS_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 517–676； UniProt 1–160 Author chain B； PDBConstruct 517–676； UniProt 1–160

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9lii
Deposition date deposition_date	2025-01-14
Structure title title	structure of phage T4 topoisomerase II central domain
Keywords keywords	topoisomerase II, ISOMERASE; ISOMERASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9lii__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9lii__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9lii__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	41.30 Å
Rg (electron density)	40.81 Å
Total Rg	41.29 Å
Atom count	11514
Residues	1430
Excluded volume	205850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9lii__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	DNA topoisomerase medium subunit
Molecular weight formula_weight	51952.0 kDa
EC 编号 ec_number	5.6.2.2
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D
Atom count atom_count	11514

MQLNNRDLKSIIDNEALAYAMYTVENRAIPNMIDGFKPVQRFVIARALDLARGNKDKFHKLASIAGGVADLGYHHGENSAQDAGALMANTWNNNFPLLDGQGNFGSRTVQKAAASRYIFARVSKNFYNVYKDTEYAPVHQDKEHIPPAFYLPIIPTVLLNGVSGIATGYATYILPHSVSSVKKAVLQALQGKKVTKPKVEFPEFRGEVVEIDGQYEIRGTYKFTSRTQMHITEIPYKYDRETYVSKILDPLENKGFITWDDACGEHGFGFKVKFRKEYSLSDNEEERHAKIMKDFGLIERRSQNITVINEKGKLQVYDNVVDLIKDFVEVRKTYVQKRIDNKIKETESAFRLAFAKAHFIKKVISGEIVVQGKTRKELTEELSKIDMYSSYVDKLVGMNIFHMTSDEAKKLAEEAKAKKEENEYWKTTDVVTEYTKDLEEIKHHHHHHHHHH

Source Source

Source organism organism	Enterobacteria phage T4
Common name common_name	Bacteriophage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	DNA topoisomerase large subunit,DNA topoisomerase small subunit
Molecular weight formula_weight	77524.7 kDa
EC 编号 ec_number	5.6.2.2
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MIKNEIKILSDIEHIKKRSGMYIGSSANETHERFMFGKWESVQYVPGLVKLIDEIIDNSVDEGIRTKFKFANKINVTIKNNQVTVEDNGRGIPQAMVKTPTGEEIPGPVAAWTIPKAGGNFGDDKERVTGGMNGVGSSLTNIFSVMFVGETGDGQNNIVVRCSNGMENKSWEDIPGKWKGTRVTFIPDFMSFETNELSQVYLDITLDRLQTLAVVYPDIQFTFNGKKVQGNFKKYARQYDEHAIVQEQENCSIAVGRSPDGFRQLTYVNNIHTKNGGHHIDCAMDDICEDLIPQIKRKFKIDVTKARVKECLTIVMFVRDMKNMRLIRQTKERLTSPFGEIRSHIQLDAKKISRDILNNEAILMPIIEAALARKLAAEKAAETKAAKKASKAKVHKHIKANLCGKDADTTLFLTEGDSAIGYLIDVRDKELHGGYPLRGKVLNSWGMSYADMLKNKELFDICAITGLVLGEKAFEEKEDGEWFTFELNGDTIIVNENDEVQINGKWITVGELRKNLMKFVKIDSSSVDMKKYKLQNNVRRSIKSSSMNYANVAIMTDADHDGLGSIYPSLLGFFSNWPELFEQGRIRFVKTPVIIAQVGKKQEWFYTVAEYESAKDALPKHSIRYIKGLGSLEKSEYREMIQNPVYDVVKLPENWKELFEMLMGDNADLRKEWMSQHHHHHH

Source Source

Source organism organism	Enterobacteria phage T4
Common name common_name	Bacteriophage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli

▶

Resolution resolution	3.06 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	137664

structure of phage T4 topoisomerase II central domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA topoisomerase medium subunit

State in the Current Structure

Other States of the Same Protein in the Database

DNA topoisomerase large subunit,DNA topoisomerase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

DNA topoisomerase large subunit,DNA topoisomerase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9lii__assembly_1__model_1

9lii__assembly_1__model_1 | I(q)

9lii__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

structure of phage T4 topoisomerase II central domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA topoisomerase medium subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA topoisomerase large subunit,DNA topoisomerase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA topoisomerase large subunit,DNA topoisomerase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9lii__assembly_1__model_1

9lii__assembly_1__model_1 | I(q)

9lii__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)