SAXSdb — 9ln8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleosome assembly protein 1-like 1

Caenorhabditis elegans

UniProt Q19007

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	H2A.Z-H2B × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q19007_CAEEL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–308； UniProt 10–296 Author chain B； PDBConstruct 22–308； UniProt 10–296

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ln8
Deposition date deposition_date	2025-01-21
Structure title title	Structure of NAP1 in complex with H2A.Z-H2B
Keywords keywords	NAP1, H2A-H2B, H3-H4, histone chaperone, nucleosome, H2A.Z, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ln8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ln8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ln8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.90 Å
Rg (electron density)	28.94 Å
Total Rg	29.84 Å
Atom count	5691
Residues	716
Excluded volume	101480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ln8__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Nucleosome assembly protein 1-like 1
Molecular weight formula_weight	34989.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5691

MGSSHHHHHHSSGENLYFQHMGLLSTNFDMIQALPLNVKQRVCALKNLQMKTIQIESDFYKRVHELEIEFEGKFKSTFDQRKAIVAGEVEPTKEQIDTPILEGLEGDQLAELYKAAEADPSAKGIKDFWLTALRTHDLVAEAIEEHDVPILSYLTDVTTAASKDPAGFKIEFHFATNPYFKNQVLTKTYLLGFDPDAEAPLQFDGPHVIRAVGDTIEWEDGKNVTKKAVKKKQKKGANAGKFLTKTVKADSFFNFFEPPKSKDERNEDEDDEQAEEFLELDYEMGQAIRDTIIPRAVLFYTGELQSDD

Source Source

Source organism organism	Caenorhabditis elegans
NCBI taxonomy ID ncbi_taxonomy_id	6239
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	H2A.Z-H2B
Molecular weight formula_weight	22481.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

HMRKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKK

Source Source

Source organism organism	Caenorhabditis elegans
NCBI taxonomy ID ncbi_taxonomy_id	6239
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	66.852 Å
Unit-cell length b length_b	79.257 Å
Unit-cell length c length_c	175.112 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	49.060 Å
R factor r_factor	0.2130
R_work r_work	0.2106
R_free r_free	0.2581

Structure of NAP1 in complex with H2A.Z-H2B

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleosome assembly protein 1-like 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ln8__assembly_1__model_1

9ln8__assembly_1__model_1 | I(q)

9ln8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of NAP1 in complex with H2A.Z-H2B

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleosome assembly protein 1-like 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ln8__assembly_1__model_1

9ln8__assembly_1__model_1 | I(q)

9ln8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)