SAXSdb — 9m3j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin beta subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 104	Allophycocyanin alpha subunit × 44 Allophycocyanin-B × 2 Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （Q7NL78） Phycobiliprotein ApcE × 2 （Q7NL81） PHYCOCYANOBILIN × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL79_GLOVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B1； PDBConstruct 1–161； UniProt 1–161 Author chain B2； PDBConstruct 1–161； UniProt 1–161 Author chain B3； PDBConstruct 1–161； UniProt 1–161 Author chain D1； PDBConstruct 1–161； UniProt 1–161 Author chain D2； PDBConstruct 1–161； UniProt 1–161 Author chain D3； PDBConstruct 1–161； UniProt 1–161 Author chain F1； PDBConstruct 1–161； UniProt 1–161 Author chain F2； PDBConstruct 1–161； UniProt 1–161 Author chain F3； PDBConstruct 1–161； UniProt 1–161 Author chain G1； PDBConstruct 1–161； UniProt 1–161 Author chain H2； PDBConstruct 1–161； UniProt 1–161 Author chain H3； PDBConstruct 1–161； UniProt 1–161 Author chain I1； PDBConstruct 1–161； UniProt 1–161 Author chain J1； PDBConstruct 1–161； UniProt 1–161 Author chain J2； PDBConstruct 1–161； UniProt 1–161 Author chain J3； PDBConstruct 1–161； UniProt 1–161 Author chain L2； PDBConstruct 1–161； UniProt 1–161 Author chain L3； PDBConstruct 1–161； UniProt 1–161 Author chain N2； PDBConstruct 1–161； UniProt 1–161 Author chain N3； PDBConstruct 1–161； UniProt 1–161 Author chain P2； PDBConstruct 1–161； UniProt 1–161 Author chain P3； PDBConstruct 1–161； UniProt 1–161 Author chain R2； PDBConstruct 1–161； UniProt 1–161 Author chain R3； PDBConstruct 1–161； UniProt 1–161 Author chain T2； PDBConstruct 1–161； UniProt 1–161 Author chain T3； PDBConstruct 1–161； UniProt 1–161 Author chain V2； PDBConstruct 1–161； UniProt 1–161 Author chain V3； PDBConstruct 1–161； UniProt 1–161 Author chain X2； PDBConstruct 1–161； UniProt 1–161 Author chain X3； PDBConstruct 1–161； UniProt 1–161 Author chain Z2； PDBConstruct 1–161； UniProt 1–161 Author chain Z3； PDBConstruct 1–161； UniProt 1–161 Author chain b2； PDBConstruct 1–161； UniProt 1–161 Author chain b3； PDBConstruct 1–161； UniProt 1–161 Author chain d2； PDBConstruct 1–161； UniProt 1–161 Author chain d3； PDBConstruct 1–161； UniProt 1–161 Author chain f2； PDBConstruct 1–161； UniProt 1–161 Author chain f3； PDBConstruct 1–161； UniProt 1–161 Author chain g3； PDBConstruct 1–161； UniProt 1–161 Author chain h2； PDBConstruct 1–161； UniProt 1–161 Author chain h3； PDBConstruct 1–161； UniProt 1–161 Author chain j2； PDBConstruct 1–161； UniProt 1–161 Author chain l2； PDBConstruct 1–161； UniProt 1–161 Author chain n2； PDBConstruct 1–161； UniProt 1–161 Author chain p2； PDBConstruct 1–161； UniProt 1–161 Author chain r2； PDBConstruct 1–161； UniProt 1–161 Author chain t2； PDBConstruct 1–161； UniProt 1–161 Author chain v2； PDBConstruct 1–161； UniProt 1–161

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt Q7NL78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 104	Allophycocyanin alpha subunit × 44 Allophycocyanin beta subunit × 48 （Q7NL79） Allophycocyanin-B × 2 Phycobiliprotein ApcE × 2 （Q7NL81） PHYCOCYANOBILIN × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL78_GLOVI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain M1； PDBConstruct 1–69； UniProt 1–69 Author chain i3； PDBConstruct 1–69； UniProt 1–69 Author chain w2； PDBConstruct 1–69； UniProt 1–69 Author chain x2； PDBConstruct 1–69； UniProt 1–69 Author chain y2； PDBConstruct 1–69； UniProt 1–69 Author chain z1； PDBConstruct 1–69； UniProt 1–69 Author chain z2； PDBConstruct 1–69； UniProt 1–69 Author chain z3； PDBConstruct 1–69； UniProt 1–69

Phycobiliprotein ApcE

OrganismNot specified

UniProt Q7NL81

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 104	Allophycocyanin alpha subunit × 44 Allophycocyanin beta subunit × 48 （Q7NL79） Allophycocyanin-B × 2 Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （Q7NL78） PHYCOCYANOBILIN × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL81_GLOVI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain j3； PDBConstruct 1–1155； UniProt 1–1155 Author chain k3； PDBConstruct 1–1155； UniProt 1–1155

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9m3j
Deposition date deposition_date	2025-03-02
Structure title title	structure of bundle-shaped PBS with both long rod and (ApcA2B3ApcD) trimer
Keywords keywords	phycobilisome, light-harvesting complex, photosynthesis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9m3j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9m3j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9m3j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.42 Å
Rg (electron density)	87.09 Å
Total Rg	87.16 Å
Atom count	140502
Residues	17800
Excluded volume	2517100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9m3j__assembly_1__model_1`	104-meric （104）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Allophycocyanin alpha subunit
Molecular weight formula_weight	17539.0 kDa
Source method src_method	nat
Copy count entity_count	44

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,C1,E1,H1,A2,C2,E2,G2,I2,K2,M2,O2,Q2,S2,U2,W2,Y2,a2,c2,e2,g2,i2,k2,m2,o2,q2,s2,u2,A3,C3,E3,G3,I3,K3,M3,O3,Q3,S3,U3,W3,Y3,a3,c3,e3
Atom count atom_count	140502

MSVLTKAIVNADAEARYLSPGELDRIKSFVASGERRLRIAQTLTEARERIVKQAGDQLFQIRPDVVSPGGNAYGEKMTALCLRDLDYYLRLVTYGIVAGDVTPIEEIGIIGVKEMYNSLQTPIPAVAEGVRAMKNVATSLLSGDDAAEAGFYFDYLVGAMQ

Entity 2 Entity 2 polymer

Description description	Allophycocyanin beta subunit
Molecular weight formula_weight	17241.7 kDa
Source method src_method	nat
Copy count entity_count	48

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;B1,D1,F1,G1,I1,J1,B2,D2,F2,H2,J2,L2,N2,P2,R2,T2,V2,X2,Z2,b2,d2,f2,h2,j2,l2,n2,p2,r2,t2,v2,B3,D3,F3,H3,J3,L3,N3,P3,R3,T3,V3,X3,Z3,b3,d3,f3,g3,h3 ;

MQDAITAVINNYDVQGKYLDGAALDKLKAYFTTGAVRVRAAAVISSNATTIIKEAAAKALIYSDLTRPGGNMYTTRRYAACIRDMDYFLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIAATVGGIQAMKEVVGGLVGPDAAKEASIYFDYLSSGLS

Entity 3 Entity 3 polymer

Description description	Allophycocyanin-B
Molecular weight formula_weight	18050.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K1,L1

MSVVLTTIMNADQQLRYPSVGELEQIKNFMEDSALRLKVAKTLSDANDRVVKQASAGLFQRRPDLNNPGGNAYGEKRLGSCIRDLGWYYRLITYSIVAGNNEPVERIGLTGIFEMYRVLEVPIPAMIESMRLLKKEALELLSPAEAEIAAPYFDYVIGAMQ

Entity 4 Entity 4 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7765.0 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z1,M1,z2,w2,x2,y2,z3,i3

MSRYFKVTACIPSLKRVRTGRELQNTFFTKLVPYENWFTEQQRIQKAGGKVLSVKLFTGVQGANTGVGA

Entity 5 Entity 5 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	130002.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j3,k3

MSIRGTSGSTVARPRLFRTVMTETINGINAEDRYPNSGEVSQLDQFFGDGQRRIAIVAKLTENAEMIVSRAANRIFVGGSPMAYSERQKAKAKSPLANDEFGNEPIVEDRGGFLESLKSIFSTRGGGGRASADFAVPPDFEPINIARYGPERMQKSIRDLDWFLRYTTYAILAGDPSILEANCLGLREILEKSCSISATIVALLEMRKNAARLFKDEADSKLVSSYISVVIRALDADRSDAPADIVRPSSEDRPGLTLPYIYKLSADSLTTFKMTAIYGADGRPKVNLSSDEKERVVRAAYRQVFERDLKAYGQSVSEAESKVKNGEISVREFVRRLGKSELYRREFYQPFINSRVLELAFKHFLGRAPESRAEVQKYFSIISSPIVRGQSSMPSGGLYALIDALIDSEEYTSIFGEDTVPYLRNLGVEAQPSWNWGAAYDLYNYAAPRRKVPQFITLFADYTQPLPNQHPYGAGNDPLEIQFGAIFKNSTINPAERAAPIGKDVKRILIRNGSPTSNERGNPTGMSEGATTLGPKIFKLTQNVGFRSKGMVQNAGVVTVEGSVQALITAAYQQIFGRQLYQGQRLKVAEIKLENGETTVKEFVRALGRSEIFRKLYWEPFYVCKAIEYIHRRLLGRPTYDRVENNRYFDIASKKGFYGVVDAMLNSNEYQEVFGEDVLPYERYLTPAGLSLRKGRFGSSDVLTTPGGITPRGDAARMMDKIQELGTPINERSIPEMYVNQGVPALKRQRKVFKQSQATDRESFDALVTAAYVQVFDKDIASYIRSEFSALESRLRNRETSVKEFVRLLGFSALYRKQFHDRYPNTKVVEFAFKHFLGRAVKNQAELIKYHGLLGRKGIKALIGALVDGEEYGRLYGEDTVPSWQFPTLPAANYPNSVELYNRFTRQDDSLVVPSFKPIRSKMDIASMPLVQAALKEQQATKTALDMSRPMFLELGRSFKGADGQSVEVGVGTLRRQLEHIYRIAPDATRSEKDVAINAIYRQVLDVFAGIPPSYLRLSEAESKLKNNEISVREFVRRLGRSENYRKRFFEPYSSPKVVELLTKHFLGRAPISQQEISTYVQILGTKGLAAAVDAIVESPEYLTIFNEDIVPYRRYPTLPAGNYRASVRVNDEELISQSWSSLSPTYTGYQYVTR

Entity 6 Entity 6 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	96

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.37 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	192814

structure of bundle-shaped PBS with both long rod and (ApcA2B3ApcD) trimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9m3j__assembly_1__model_1

9m3j__assembly_1__model_1 | I(q)

9m3j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

structure of bundle-shaped PBS with both long rod and (ApcA2B3ApcD) trimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9m3j__assembly_1__model_1

9m3j__assembly_1__model_1 | I(q)

9m3j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)