SAXSdb — 9mvz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MmpL5 protein

Mycolicibacterium smegmatis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Meromycolate extension acyl carrier protein × 3 （A0R0B3） MmpS5 protein × 3 （A0QS79） 4'-PHOSPHOPANTETHEINE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QS80_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D； PDBConstruct 1–967； UniProt 1–967 Author chain E； PDBConstruct 1–967； UniProt 1–967 Author chain F； PDBConstruct 1–967； UniProt 1–967

Meromycolate extension acyl carrier protein

Mycolicibacterium smegmatis

UniProt A0R0B3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	MmpL5 protein × 3 （A0QS80） MmpS5 protein × 3 （A0QS79） 4'-PHOSPHOPANTETHEINE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MYCS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–99； UniProt 1–99 Author chain H； PDBConstruct 1–99； UniProt 1–99 Author chain I； PDBConstruct 1–99； UniProt 1–99

MmpS5 protein

Mycolicibacterium smegmatis

UniProt A0QS79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	MmpL5 protein × 3 （A0QS80） Meromycolate extension acyl carrier protein × 3 （A0R0B3） 4'-PHOSPHOPANTETHEINE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QS79_MYCS2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–138； UniProt 1–138 Author chain B； PDBConstruct 1–138； UniProt 1–138 Author chain C； PDBConstruct 1–138； UniProt 1–138

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9mvz
Deposition date deposition_date	2025-01-16
Structure title title	Tripartite complex of MmpL5-S5-AcpM from Mycolicibacterium smegmatis
Keywords keywords	MmpL5, MmpS5, AcpM, membrane protein, Tripartite complex; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9mvz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9mvz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9mvz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	62.44 Å
Rg (electron density)	63.56 Å
Total Rg	63.43 Å
Atom count	26415
Residues	3468
Excluded volume	473760 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9mvz__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	MmpL5 protein
Molecular weight formula_weight	105598.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F
Atom count atom_count	26415

MSAPTDDTPTDAIAAPRHSAPPRPRLPWFLRTFAVPIILAWVAVVAILNTVVPTLDEVGEMRAVSMAPNDAPSTLAIKRVGQVFEEYDTSSSVMIVLEGEEPLGIEAHAFYDKMVADLRADTEHVQHVQDFWGDTLTASGAQSVDGKAAYVQVYIAGDQGESLANESVEAVRKIATERETPSGVKAYVTGAAATSADQRAEGDASMKLIEGVTFAVITVMLLAVYRSVITTLIVLAMVVLGLSGARGIVAFLGFYNVFGLTTFATNMVVTLAIAAATDYAIFLIGRYQEARRAGEDRESAYYTMFHGTAHVVLASGLTIAGATLCLHFTRLPYFQTMGVPLAIGMLIVVAAALTAGPAVISVVSRFGKTLEPKRFSRSPGWHRVGTATVRWPGAILVCAVVAALIGLLALPGYYTTYDDRRYLPDDVPANVGYDAAFRHFSQAKMNPDLMMVETDRDLRNPADFLVIDKIAKALKNVHGIAQVQTITRPDGDPIEHSTIPYTIGQSGTTQIMNNDYMQTNLDNLLKQADDLQTSIDSMTEMMNIQTELAAVSQSMADKMAQTSDDTADVRDHLADFDDFFRPIRNYLYWEPHCYDIPMCWSMRSIFESIDGINTMSDDFQELVPEMRRMADLMPRMVAVMPAQIQSMKNQKQTLLNQYQVQKAQQDQNMAMQENATAMSQAFDAAKNDDSFYLPPEAFETDDFQRGMKLFMSPDGHAVRFTIIHQGDPLTEEGTARMDELKVAAADAIKGTPFEGARIYLGGSAATYNDMQIGADYDLIIVAASALILIFIIMMVLTRAVVAAAVIVGTVVLSLASAFGLSVLLWQHIVGIPLHWMVLPMSVIVLLAVGADYNLLLVSRMKEEIHAGIRTGIIRAMVGTGAVVTAAGLVFAFTMASMAVSSLITIGQVGTTIGLGLLFDTLVVRSLMTPSIATLLGRWFWWPQRVRERPVPSKWPTPIQRTPEEALS

Source Source

Source organism organism	Mycolicibacterium smegmatis
NCBI taxonomy ID ncbi_taxonomy_id	1772
Host organism host_organism	Mycolicibacterium smegmatis

Entity 2 Entity 2 polymer

Description description	Meromycolate extension acyl carrier protein
Molecular weight formula_weight	10743.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I

MAATQEEIIAGLAEIIEEVTGIEPSEVTPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAAALREKFAADQ

Source Source

Source organism organism	Mycolicibacterium smegmatis
NCBI taxonomy ID ncbi_taxonomy_id	1772
Host organism host_organism	Mycolicibacterium smegmatis

Entity 3 Entity 3 polymer

Description description	MmpS5 protein
Molecular weight formula_weight	14905.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,A,B

MLGRIWLPVLIVVAVAAGALIVMNVRTVFGSNPVVVTEKTSDNAEDFNPKVVTYEIFGSGSSAVINYMDLEGMPQRVESTPLPWSLTLQTTLPSVMPHIMAQGDGDSITCRVTVDDVVKEERTATGMNAETFCYVKAA

Source Source

Source organism organism	Mycolicibacterium smegmatis
NCBI taxonomy ID ncbi_taxonomy_id	1772
Host organism host_organism	Mycolicibacterium smegmatis

Entity 4 Entity 4 non-polymer

Description description	4'-PHOSPHOPANTETHEINE
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.81 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	31880

Tripartite complex of MmpL5-S5-AcpM from Mycolicibacterium smegmatis

1. Protein Identity and Related Structures Protein Identity & Related Structures

MmpL5 protein

State in the Current Structure

Other States of the Same Protein in the Database

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

MmpS5 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mvz__assembly_1__model_1

9mvz__assembly_1__model_1 | I(q)

9mvz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)

Tripartite complex of MmpL5-S5-AcpM from Mycolicibacterium smegmatis

1. Protein Identity and Related Structures Protein Identity & Related Structures

MmpL5 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MmpS5 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mvz__assembly_1__model_1

9mvz__assembly_1__model_1 | I(q)

9mvz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)