SAXSdb — 9p6h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gliding motility protein GldN

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 2 其他Polymer 3	Lipoprotein, putative × 1 （Q7MXB7） ;2-acetamido-2-deoxy-beta-D-galactopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-galactopyranose-(1-4)-beta-L-fucopyranose-(1-4)-beta-D-glucopyranose-(1-4)-alpha-D-glucopyranuronic acid-(1-2)-[alpha-L-rhamnopyranose-(1-4)]alpha-D-mannopyranose ; × 2 beta-D-glucopyranose-(1-4)-alpha-D-glucopyranuronic acid-(1-2)-[alpha-L-rhamnopyranose-(1-4)]alpha-D-mannopyranose × 1 beta-D-mannopyranose × 2 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7MXB4_PORGI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–254； UniProt 50–303

Lipoprotein, putative

OrganismNot specified

UniProt Q7MXB7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 2 其他Polymer 3	Gliding motility protein GldN × 1 （Q7MXB4） ;2-acetamido-2-deoxy-beta-D-galactopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-galactopyranose-(1-4)-beta-L-fucopyranose-(1-4)-beta-D-glucopyranose-(1-4)-alpha-D-glucopyranuronic acid-(1-2)-[alpha-L-rhamnopyranose-(1-4)]alpha-D-mannopyranose ; × 2 beta-D-glucopyranose-(1-4)-alpha-D-glucopyranuronic acid-(1-2)-[alpha-L-rhamnopyranose-(1-4)]alpha-D-mannopyranose × 1 beta-D-mannopyranose × 2 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7MXB7_PORGI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–447； UniProt 34–480

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9p6h
Deposition date deposition_date	2025-06-19
Structure title title	Structure of P. gingivalis PorK and PorN complexes from cryo electron microscopy
Keywords keywords	T9SS, porphyromonas gingivalis, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9p6h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9p6h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9p6h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.88 Å
Rg (electron density)	30.17 Å
Total Rg	30.86 Å
Atom count	5963
Residues	701
Excluded volume	105300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9p6h__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Gliding motility protein GldN
Molecular weight formula_weight	30080.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5963

LSNRAQEFNRRLTQKTDNAPWRRVVYRRVDLMEESNAVLYYPPRPIGDRKNLFSTIFGLINSNSLDVYEYLDGFEAFTDQYKIKFQEFLDRFGIYYQPSTNKNAELFKVADSDIPSAEVKAYYVKEEWYFTPTNSDVDIKIQAICPIMTGQDEFGEVRNQPLFWIPYENIRPYIARERVMLSSLNNTRNSTIDDFFRLNLYKGDIVKTENLHNRALAEYCPTPDSMKMESKRIDKELQGFRDGLFVTQDTTWMK

Entity 2 Entity 2 polymer

Description description	Lipoprotein, putative
Molecular weight formula_weight	51184.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ELTGAKLSSWNEPSPFGMIQVPRGSIVLGNKEADSLWGIPAESRPISVDAFWMDRTEITNAQYRQFVYYVRDSIIRERLADPAYGGNEEYKITENKFGEPVTPHLDWSKPIPSEKRATEEEIAAINSVYYTNPVTHDRKLNPDQMVYRYEVYDYRSAALREHQLKAAKRNLNTDIKVDPNAVVMISKDTAFVDESGNIISETITRPLSSEYDFLNTYIVPIYPDETCWVNDFPNARTEIYTRMYFNHPGYDDYPVVGISWEQAQAFCAWRSEFFRKGIRLPEGQIMDDFRLPTEAEWEYAARMGDSNNKYPWSTEDLRTGRGCFLGNFKPGEGDYTADGHLIPSRVSSFSPNDFGLYDMAGNVAEWTSTAFSESGLKQMSDINPELEYKAALTDPYILKQKVVRGGSWKDVARFIRSATRSHEYQNVGRSYIGFRCVRTSIAFSSGK

Entity 3 Entity 3 branched

Description description	;2-acetamido-2-deoxy-beta-D-galactopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-galactopyranose-(1-4)-beta-L-fucopyranose-(1-4)-beta-D-glucopyranose-(1-4)-alpha-D-glucopyranuronic acid-(1-2)-[alpha-L-rhamnopyranose-(1-4)]alpha-D-mannopyranose ;
Molecular weight formula_weight	1217.1 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 4 Entity 4 branched

Description description	beta-D-glucopyranose-(1-4)-alpha-D-glucopyranuronic acid-(1-2)-[alpha-L-rhamnopyranose-(1-4)]alpha-D-mannopyranose
Molecular weight formula_weight	664.6 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	beta-D-mannopyranose
Molecular weight formula_weight	180.2 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.75 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	69982

Structure of P. gingivalis PorK and PorN complexes from cryo electron microscopy

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gliding motility protein GldN

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein, putative

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9p6h__assembly_1__model_1

9p6h__assembly_1__model_1 | I(q)

9p6h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (2)

Structure of P. gingivalis PorK and PorN complexes from cryo electron microscopy

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gliding motility protein GldN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Lipoprotein, putative

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9p6h__assembly_1__model_1

9p6h__assembly_1__model_1 | I(q)

9p6h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (2)