9pdl

Nub1/Fat10-processing human 26S proteasome with Rpt5 at top of spiral staircase (AAA+ locally refined)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S protease regulatory subunit 8

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS8_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–406； UniProt 1–406

Proteasome subunit alpha type-6

Homo sapiens

UniProt P60900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–246； UniProt 1–246

Proteasome subunit alpha type-2

Homo sapiens

UniProt P25787

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-4

Homo sapiens

UniProt P25789

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit alpha type-7

Homo sapiens

UniProt O14818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain J； PDBConstruct 1–248； UniProt 1–248

Proteasome subunit alpha type-1

Homo sapiens

UniProt P25786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit alpha type-3

Homo sapiens

UniProt P25788

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–255； UniProt 1–255

26S proteasome non-ATPase regulatory subunit 14

Homo sapiens

UniProt O00487

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSDE_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain c； PDBConstruct 1–310； UniProt 1–310

26S proteasome regulatory subunit 7

Homo sapiens

UniProt P35998

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS7_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A； PDBConstruct 1–433； UniProt 1–433

26S proteasome regulatory subunit 4

Homo sapiens

UniProt P62191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS4_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B； PDBConstruct 1–440； UniProt 1–440

26S proteasome regulatory subunit 6B

Homo sapiens

UniProt P43686

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6B_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain D； PDBConstruct 1–418； UniProt 1–418

26S protease regulatory subunit 10B

Homo sapiens

UniProt P62333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome regulatory subunit 6A × 1 （P17980） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS10_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain E； PDBConstruct 1–389； UniProt 1–389

26S proteasome regulatory subunit 6A

Homo sapiens

UniProt P17980

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） Proteasome subunit alpha type-5 × 1 （P28066） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6A_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain F； PDBConstruct 1–439； UniProt 1–439

Proteasome subunit alpha type-5

Homo sapiens

UniProt P28066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	26S protease regulatory subunit 8 × 1 （P62195） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） Substrate polypeptide × 1 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S protease regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） ADENOSINE-5'-DIPHOSPHATE × 3 MAGNESIUM ION × 5 ZINC ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain K； PDBConstruct 1–241； UniProt 1–241

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9pdl
Deposition date deposition_date	2025-06-30
Structure title title	Nub1/Fat10-processing human 26S proteasome with Rpt5 at top of spiral staircase (AAA+ locally refined)
Keywords keywords	26S Proteasome, MOTOR PROTEIN, HYDROLASE-PROTEIN BINDING complex; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9pdl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9pdl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9pdl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.39 Å
Rg (electron density)	52.19 Å
Total Rg	52.36 Å
Atom count	33269
Residues	4236
Excluded volume	593930 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9pdl__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	26S protease regulatory subunit 8
Molecular weight formula_weight	45694.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	33269

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27432.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25927.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29525.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	27957.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVVEIEKEKEENEKKKQKKAS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	29595.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28469.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	26S proteasome non-ATPase regulatory subunit 14
Molecular weight formula_weight	46940.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFKLINHHHHHHDYDIPTTASENLYFQGELGMRGSAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIGVHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	Substrate polypeptide
Molecular weight formula_weight	1039.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

XXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	26S proteasome regulatory subunit 7
Molecular weight formula_weight	48700.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 polymer

Description description	26S proteasome regulatory subunit 4
Molecular weight formula_weight	49260.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	26S proteasome regulatory subunit 6B
Molecular weight formula_weight	47426.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	26S protease regulatory subunit 10B
Molecular weight formula_weight	44241.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	26S proteasome regulatory subunit 6A
Molecular weight formula_weight	49266.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 15 Entity 15 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26494.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIKDAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 16 Entity 16 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 17 Entity 17 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 18 Entity 18 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.76 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	66749

Nub1/Fat10-processing human 26S proteasome with Rpt5 at top of spiral staircase (AAA+ locally refined)

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S protease regulatory subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer