SAXSdb — 9pfn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

POU domain, class 2, transcription factor 3

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 2 DNA 2	POU class 2 homeobox associating factor 3 × 1 （A8K830） DNA containing POU domain recognition element octamer (sense strand) × 1 DNA containing POU domain recognition element octamer (antisense strand) × 1 water × 3	Consistent with all polymers
2	Protein–DNA	Heteromer	Protein 2 DNA 2	POU class 2 homeobox associating factor 3 × 1 （A8K830） DNA containing POU domain recognition element octamer (sense strand) × 1 DNA containing POU domain recognition element octamer (antisense strand) × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PO2F3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–160； UniProt 183–341 Author chain E； PDBConstruct 2–160； UniProt 183–341

POU class 2 homeobox associating factor 3

Homo sapiens

UniProt A8K830

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 2 DNA 2	POU domain, class 2, transcription factor 3 × 1 （Q9UKI9） DNA containing POU domain recognition element octamer (sense strand) × 1 DNA containing POU domain recognition element octamer (antisense strand) × 1 water × 3	Consistent with all polymers
2	Protein–DNA	Heteromer	Protein 2 DNA 2	POU domain, class 2, transcription factor 3 × 1 （Q9UKI9） DNA containing POU domain recognition element octamer (sense strand) × 1 DNA containing POU domain recognition element octamer (antisense strand) × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OCAT2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–39； UniProt 1–38 Author chain F； PDBConstruct 2–39； UniProt 1–38

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9pfn
Deposition date deposition_date	2025-07-06
Structure title title	Structure of POU2F3 POU domains bound to coactivator OCA-T2 and DNA (2.8 angstrom resolution)
Keywords keywords	transcription factor, DNA binding, coactivator complex, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9pfn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9pfn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9pfn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.09 Å
Rg (electron density)	19.84 Å
Total Rg	20.50 Å
Atom count	3784
Residues	201
Excluded volume	33838 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9pfn__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9pfn__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	POU domain, class 2, transcription factor 3
Molecular weight formula_weight	18503.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	7401

GDEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	POU class 2 homeobox associating factor 3
Molecular weight formula_weight	4218.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

GMSEKPKVYQGVRVKITVKELLQQRRAHQAASGGTRSGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	DNA containing POU domain recognition element octamer (sense strand)
Molecular weight formula_weight	4657.1 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C,G

TGTATGCAAATAAGG

Entity 4 Entity 4 polymer

Description description	DNA containing POU domain recognition element octamer (antisense strand)
Molecular weight formula_weight	4519.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D,H

ACCTTATTTGCATAC

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	6

▶

Unit-cell length a length_a	81.165 Å
Unit-cell length b length_b	36.022 Å
Unit-cell length c length_c	88.598 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.08 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.790 Å
Low-resolution limit resolution_low	38.910 Å
R factor r_factor	0.2385
R_work r_work	0.2358
R_free r_free	0.2956

Structure of POU2F3 POU domains bound to coactivator OCA-T2 and DNA (2.8 angstrom resolution)

1. Protein Identity and Related Structures Protein Identity & Related Structures

POU domain, class 2, transcription factor 3

State in the Current Structure

Other States of the Same Protein in the Database

POU class 2 homeobox associating factor 3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pfn__assembly_1__model_1

9pfn__assembly_1__model_1 | I(q)

9pfn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 water

7. Citations (1)

Structure of POU2F3 POU domains bound to coactivator OCA-T2 and DNA (2.8 angstrom resolution)

1. Protein Identity and Related Structures Protein Identity & Related Structures

POU domain, class 2, transcription factor 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

POU class 2 homeobox associating factor 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pfn__assembly_1__model_1

9pfn__assembly_1__model_1 | I(q)

9pfn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 water

7. Citations (1)