SAXSdb — 9pxf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ammonia monooxygenase subunit C

Nitrosospira briensis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Ammonia monooxygenase subunit A × 3 （A0A1I5FI55） Ammonia monooxygenase subunit B × 3 （A0A1I5FIF1） COPPER (II) ION × 9 (4S,7R)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSAN-1-AMINIUM 4-OXIDE × 3 water × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1G4ZCX6_9PROT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain G； PDBConstruct 1–251； UniProt 19–269 Author chain H； PDBConstruct 1–251； UniProt 19–269 Author chain I； PDBConstruct 1–251； UniProt 19–269

Ammonia monooxygenase subunit A

Nitrosospira briensis

UniProt A0A1I5FI55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Ammonia monooxygenase subunit C × 3 （A0A1G4ZCX6） Ammonia monooxygenase subunit B × 3 （A0A1I5FIF1） COPPER (II) ION × 9 (4S,7R)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSAN-1-AMINIUM 4-OXIDE × 3 water × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1I5FI55_9PROT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–273； UniProt 2–274 Author chain E； PDBConstruct 1–273； UniProt 2–274 Author chain F； PDBConstruct 1–273； UniProt 2–274

Ammonia monooxygenase subunit B

Nitrosospira briensis

UniProt A0A1I5FIF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Ammonia monooxygenase subunit C × 3 （A0A1G4ZCX6） Ammonia monooxygenase subunit A × 3 （A0A1I5FI55） COPPER (II) ION × 9 (4S,7R)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSAN-1-AMINIUM 4-OXIDE × 3 water × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1I5FIF1_9PROT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–381； UniProt 34–414 Author chain B； PDBConstruct 1–381； UniProt 34–414 Author chain C； PDBConstruct 1–381； UniProt 34–414

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9pxf
Deposition date deposition_date	2025-08-05
Structure title title	Ammonia monooxygenase in native membranes from N. briensis
Keywords keywords	ammonia oxidation, copper enzyme, membrane protein, active site, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9pxf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9pxf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9pxf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.62 Å
Rg (electron density)	42.56 Å
Total Rg	43.10 Å
Atom count	22338
Residues	2715
Excluded volume	399440 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9pxf__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Ammonia monooxygenase subunit C
Molecular weight formula_weight	29534.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I
Atom count atom_count	23186

DMSEWYDSRWYKFGLITMLLVAIFWVWYQRTYAYSHGMDSMEPEFEKVWMGLWRVHMIVMPIFALITWGWIWKTRDTNLDNLDPKLEVKRYFYWMMWLGVYLFGVYWGGSFFTEQDASWHQVIIRDTSFTPSHVVVFYGSFPMYIVCGVASYLYAMTRLPLYSRGTSFPLVMAIAGPLMILPNVGLNEWGHAFWFMEELFSAPLHWGFVILGWSGLFAGGIAAQIITRYSNLTDVVWNGQSKVILNNRIVP

Source Source

Source organism organism	Nitrosospira briensis
NCBI taxonomy ID ncbi_taxonomy_id	35799
Host organism host_organism	Nitrosospira briensis

Entity 2 Entity 2 polymer

Description description	Ammonia monooxygenase subunit A
Molecular weight formula_weight	31288.8 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

SRTDEILKAAKMPPEAVKMSRMIDAVYFPILCILLVGTYHMHFMLLAGDWDFWLDWKDRQWWPVVTPIVGITYCAAIMYYLWVNYRLPFGATLCIVCLLTGEWLTRFWGFYWWSHYPISFVFPSTMIPGALVMDTVMLLTRNWMITALVGGGAFGLLFYPGNWTIFGPTHLPLVAEGVLLSVADYTGFLYVRTGTPEYVRLIEQGSLRTFGGHTTVIASFFAAFVSMLMFCVWWYFGKLYCTAFFYVKGARGRVTMKNDVTAFGEEGFPEGIK

Source Source

Source organism organism	Nitrosospira briensis
NCBI taxonomy ID ncbi_taxonomy_id	35799
Host organism host_organism	Nitrosospira briensis

Entity 3 Entity 3 polymer

Description description	Ammonia monooxygenase subunit B
Molecular weight formula_weight	42675.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C

HGERSQEPFLRMRTIQWYDMKWGPETTKVNDFASMTGKFHLAEDWPRAVGKPGRAFFNVGSPSPVFVRLSTKLNGEPTMISGPLEIGRDYAFEVKLKARIPGRHHMHAMVNIKDAGPIAGPAAWMNITGSWDDFTNPIKLLTGETIDTETFNFSNGIFWHALWMALGIFWIGYYVARPMFLPRSRVLLAYGDELLIDPMDKKVAWVVLILTLGIVWGGYRYTENKHPYTVPIQAGESKVAPLPVKPNPIAIKVTHANYDVPGRALRVTMMVTNSGDSAYRIGEFTTAGVRFINKVGLKHMDRGYPKELVATGLSFDNDTPIQPGETREVKMEAKDALWEVQRLMALLGDPESRFGGLLMTWNDAGDRNINSIAGAVIPVFT

Source Source

Source organism organism	Nitrosospira briensis
NCBI taxonomy ID ncbi_taxonomy_id	35799
Host organism host_organism	Nitrosospira briensis

Entity 4 Entity 4 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 5 Entity 5 non-polymer

Description description	(4S,7R)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSAN-1-AMINIUM 4-OXIDE
Molecular weight formula_weight	763.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	848

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.58 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	212075

Ammonia monooxygenase in native membranes from N. briensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ammonia monooxygenase subunit C

State in the Current Structure

Other States of the Same Protein in the Database

Ammonia monooxygenase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Ammonia monooxygenase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pxf__assembly_1__model_1

9pxf__assembly_1__model_1 | I(q)

9pxf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Ammonia monooxygenase in native membranes from N. briensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ammonia monooxygenase subunit C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ammonia monooxygenase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ammonia monooxygenase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pxf__assembly_1__model_1

9pxf__assembly_1__model_1 | I(q)

9pxf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)