SAXSdb — 9pxi

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer membrane protein assembly factor BamD

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Outer membrane protein assembly factor BamC × 1 （Q9I4W2） Outer membrane protein assembly factor BamB × 1 （Q9HXJ7） Outer membrane protein assembly factor BamA × 1 （Q9HXY4） Outer membrane protein assembly factor BamE × 1 （O68562） Pyocin L1 × 1 （T2LG16）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BAMD_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D； PDBConstruct 1–341； UniProt 1–341

Outer membrane protein assembly factor BamC

OrganismNot specified

UniProt Q9I4W2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Outer membrane protein assembly factor BamD × 1 （P33641） Outer membrane protein assembly factor BamB × 1 （Q9HXJ7） Outer membrane protein assembly factor BamA × 1 （Q9HXY4） Outer membrane protein assembly factor BamE × 1 （O68562） Pyocin L1 × 1 （T2LG16）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9I4W2_PSEAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–396； UniProt 1–396

Outer membrane protein assembly factor BamB

OrganismNot specified

UniProt Q9HXJ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Outer membrane protein assembly factor BamD × 1 （P33641） Outer membrane protein assembly factor BamC × 1 （Q9I4W2） Outer membrane protein assembly factor BamA × 1 （Q9HXY4） Outer membrane protein assembly factor BamE × 1 （O68562） Pyocin L1 × 1 （T2LG16）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BAMB_PSEAE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–380； UniProt 1–380

Outer membrane protein assembly factor BamA

OrganismNot specified

UniProt Q9HXY4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Outer membrane protein assembly factor BamD × 1 （P33641） Outer membrane protein assembly factor BamC × 1 （Q9I4W2） Outer membrane protein assembly factor BamB × 1 （Q9HXJ7） Outer membrane protein assembly factor BamE × 1 （O68562） Pyocin L1 × 1 （T2LG16）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HXY4_PSEAE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–834； UniProt 1–797

Outer membrane protein assembly factor BamE

OrganismNot specified

UniProt O68562

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Outer membrane protein assembly factor BamD × 1 （P33641） Outer membrane protein assembly factor BamC × 1 （Q9I4W2） Outer membrane protein assembly factor BamB × 1 （Q9HXJ7） Outer membrane protein assembly factor BamA × 1 （Q9HXY4） Pyocin L1 × 1 （T2LG16）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BAME_PSEAE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–176； UniProt 1–176

Pyocin L1

Pseudomonas aeruginosa

UniProt T2LG16

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Outer membrane protein assembly factor BamD × 1 （P33641） Outer membrane protein assembly factor BamC × 1 （Q9I4W2） Outer membrane protein assembly factor BamB × 1 （Q9HXJ7） Outer membrane protein assembly factor BamA × 1 （Q9HXY4） Outer membrane protein assembly factor BamE × 1 （O68562）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2LG16_PSEAI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 21–276； UniProt 1–256

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9pxi
Deposition date deposition_date	2025-08-05
Structure title title	Cryo-EM structure of BAM from P. aeruginosa PAO1 in complex with Pyocin L1
Keywords keywords	;protein complex, outer membrane, beta-barrel, protein folding, Gram-negative bacterial protein, L-type bacteriocin, pyocin, MEMBRANE PROTEIN ;; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9pxi__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9pxi__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9pxi__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.09 Å
Rg (electron density)	51.27 Å
Total Rg	51.28 Å
Atom count	12801
Residues	1640
Excluded volume	226520 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9pxi__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Outer membrane protein assembly factor BamD
Molecular weight formula_weight	38660.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D
Atom count atom_count	12801

MQVKHLLLIAILALTAACSSNKETVDENLSESQLYQQAQDDLNNKSYNSAVTKLKALESRYPFGRYAEQAQLELIYANYKNMEPEAARAAAERFIRLHPQHPNVDYAYYLKGLSSFDQDRGLLARFLPLDMTKRDPGAARDSFNEFAQLTSRFPNSRYAPDAKARMVYLRNLLAAYEVHVGHYYLKRQAYVAAANRGRYVVENFQETPAVGDGLAIMVEAYRRLGLDDLASTSLETLKLNYPDNASLKDGEFVARESEADTRSWLAKATLGLIEGGEPPPHMETQAAKDVIKQYEDAEREIPAELKPENQDHSADDEKPESDDDEDSGRSWWSYMTFGLFD

Entity 2 Entity 2 polymer

Description description	Outer membrane protein assembly factor BamC
Molecular weight formula_weight	43100.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MKRLAGLTALALVIGNTSGCGWLWGPEGYFRDRGDDYLGARETPPMQLPEGVHSKPLDPLLPIPLNVATTHEKEGEYEVPRPQPLANAGDISDYSLQRSGDSRWVVAQRPPAEVWPVARQFFEENGFRIADERPQTGEFSSDWQSLSQLSAPLARRLSSRVSGVEPDGQARVRVRIEPGVQSNTSEVYVLSQTRAAGDTSSPSWPSKSVAPSLDAALLDEMVASMARSAEQGGSVSLLAANSIYDTPGTFELSKDGSGNPVLTLQSDFDRSWVSVGRALDNADIRVDDLNRSLGVYYVNIAEGAKKPDEDKPGFFSRLFGGGEKTKEEEDAKAQRYQVRLTTVSDAVQVTVDKDINTSAPADVAQNVLEKLQESMRNAVRGSGQRKPGQFGLGEQF

Entity 3 Entity 3 polymer

Description description	Outer membrane protein assembly factor BamB
Molecular weight formula_weight	40436.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MVQWKHAALLALALAVVGCSSNSKKELPPAELTDFKEEVVLSKQWSRSVGDGQGDLYNLLEPAVDGSTIYAASAEGRVMAIQRETGDVLWKKDLERPVSGGVGVGYGLVLVGTLRGDVIALDEATGKKKWTKRVNSEVLSAPATNGDVVVVQTQDDKLIGLDAASGDQRWIYESTVPVLTLRGTGAPLIAGNMALAGLASGKVVAVDVQRGLPIWEQRVAIPQGRSELDRVVDIDGGLLLSGDTLYVVSYQGRAAALDVNSGRLLWQREASSYVGVAEGFGNIYVSQASGSVEGLDSRGASSLWNNDALARRQLSAPAVFSSNVVVGDLEGYVHLLSQVDGRFVGRERVDSDGVRVRPLVVGSWMYVFGNGGKLVAYTIR

Entity 4 Entity 4 polymer

Description description	Outer membrane protein assembly factor BamA
Molecular weight formula_weight	92258.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MKRFLLPALLSALMIAEVHAESAWSHPQFEKGGGSGGGSGGSAWSHPQFEKENLYFQGSFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQATRSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGEIFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVVGNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTTTSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDEVLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPSGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGLTRSEYQTRYNFGFVDPYWTVDGVSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGRYTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYKIDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPRSTPSVARNPDGTPMKNQGPDSKGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQLRTVLFWDVGSTFDTDCPTKTTTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKPDNAETQVFQFSLGQTF

Entity 5 Entity 5 polymer

Description description	Outer membrane protein assembly factor BamE
Molecular weight formula_weight	19411.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MQNAKLMLTCLAFAGLAALAGCSFPGVYKIDIQQGNVVTQDMIDQLRPGMTRRQVRFIMGNPLIVDTFHANRWDYLYSIQPGGGRRQQERVSLFFNDSDQLAGLNGDFMPGVSRDEAILGKEGSTTVTQPADQQKPEAQKEEPPKPGSTLEQLQREVDEAQPVPVPTPEPLDPSPQ

Entity 6 Entity 6 polymer

Description description	Pyocin L1
Molecular weight formula_weight	30609.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MGSSHHHHHHSSGLVPRGSHMASSLAPRQVIRDGQFITSPNGKYKLVMQADGNLVLYEDGTKPIWNTTPVGPGAKAVMEFNLNLYNKAGQVAWSSNVYTAYLFEEFKDEAYLNLQDDGDFGIFSDEAKWGSIVLSRPEVGVKNKIIPTGTVMVPGTEYINGNYRLAFQGDGNLVIYQINPQVVIWATYTMGADRAVVQEDGNFVIYKGTTALWHTHTATGMPAYLKFTNTGKLFLSQPTLLWTLKRGSLSKPPKVIPGQHGPLDTTPIWSWPHDYP

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.85 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	110600

Cryo-EM structure of BAM from P. aeruginosa PAO1 in complex with Pyocin L1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer membrane protein assembly factor BamD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Outer membrane protein assembly factor BamC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Outer membrane protein assembly factor BamB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Outer membrane protein assembly factor BamA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Outer membrane protein assembly factor BamE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pyocin L1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pxi__assembly_1__model_1

9pxi__assembly_1__model_1 | I(q)

9pxi__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)