← Back to search

9qb0

;Protein kinase CK2 catalytic subunit alpha' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07 ;

Method: X-RAY DIFFRACTION D_max: 70.8 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qb0
deposition_date	2025-02-28
last_revision	2026-01-14
title	;Protein kinase CK2 catalytic subunit alpha' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07 ;
keywords	CK2, fragment-based screening, protein kinase, protein kinase CK2, casein kinase II, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.61 Å
rg_electron	20.42 Å
i0	25309800.00
molecular_weight	39273.0 kDa
excluded_volume	49474 Å³
envelope_volume	56815 Å³
shell_volume	23007 Å³
envelope_diameter	70.1 Å
shell_rg	27.38 Å
envelope_rg	20.69 Å
shape_rg	20.42 Å
total_rg	21.31 Å
total_atoms	5520
n_residues	327
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	70.8 Å
rg_real	21.52 Å
rg_real_error	0.36 Å
i0_real	2.5310e+07
i0_real_error	2.8520e+05
rg_reciprocal	21.54 Å
i0_reciprocal	25310000.0000
total_estimate	0.8871
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	26.0 Å
skewness	0.240
kurtosis	-0.372
angular_range	— – 0.3700 Å⁻¹
current_alpha	0.0000
highest_alpha	7720000.0000
n_real_points	69
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.852; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.973

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	;Casein kinase II subunit alpha' ;
formula_weight	43432.5 kDa
ec_number	2.7.11.1
mutation	C336S
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	5890

MGSSHHHHHHSSGLVPRGSHMPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPSADNAVLSSGLTAAR

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide
formula_weight	217.2 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	nat
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	253

▶

6. Citations (1)

▶

length_a	46.478 Å
length_b	47.654 Å
length_c	50.528 Å
angle_alpha	66.38 °
angle_beta	89.76 °
angle_gamma	88.32 °
z_pdb	1

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	1.010 Å
resolution_low	32.930 Å
r_factor	0.1397
r_work	0.1396
r_free	0.1558

fit	/app/data/saxs_computation/qb/9qb0/9qb0.fit
pddf	/app/data/pr_computation/qb/9qb0/9qb0.pr.out
profile	/app/data/saxs_computation/qb/9qb0/9qb0.dat

;Protein kinase CK2 catalytic subunit alpha' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07 ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction