9qf4

Structure of P. furiosus 70S ribosome grown at 95 degC

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Small ribosomal subunit protein uS2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS2_PYRFU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–202； UniProt 1–202

Small ribosomal subunit protein uS3

OrganismNot specified

UniProt Q8U004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3_PYRFU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–210； UniProt 1–210

Small ribosomal subunit protein eS1

OrganismNot specified

UniProt Q8TZE1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3A_PYRFU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Ac； PDBConstruct 1–198； UniProt 1–198

Small ribosomal subunit protein uS4

OrganismNot specified

UniProt P61993

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4_PYRFU
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Ad； PDBConstruct 1–180； UniProt 1–180

Small ribosomal subunit protein eS4

OrganismNot specified

UniProt Q8U011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4E_PYRFU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Ae； PDBConstruct 1–243； UniProt 1–243

Small ribosomal subunit protein uS5

OrganismNot specified

UniProt Q8U017

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS5_PYRFU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Af； PDBConstruct 1–236； UniProt 1–236

Small ribosomal subunit protein eS6

OrganismNot specified

UniProt Q8U3H8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6E_PYRFU
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Ag； PDBConstruct 1–125； UniProt 1–125

Small ribosomal subunit protein uS7

OrganismNot specified

UniProt Q8U0M8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS7_PYRFU
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Ah； PDBConstruct 1–215； UniProt 1–215

Small ribosomal subunit protein uS8

OrganismNot specified

UniProt Q8U014

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8_PYRFU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Ai； PDBConstruct 1–130； UniProt 1–130

Small ribosomal subunit protein eS8

OrganismNot specified

UniProt Q8U1Y5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8E_PYRFU
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Aj； PDBConstruct 1–127； UniProt 1–127

Small ribosomal subunit protein uS9

OrganismNot specified

UniProt Q8U0E7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_PYRFU
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Ak； PDBConstruct 1–135； UniProt 1–135

Small ribosomal subunit protein uS10

OrganismNot specified

UniProt P61885

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS10_PYRFU
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Al； PDBConstruct 1–102； UniProt 1–102

Small ribosomal subunit protein uS11

OrganismNot specified

UniProt Q8U0E3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS11_PYRFU
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Am； PDBConstruct 1–137； UniProt 1–137

Small ribosomal subunit protein uS12

OrganismNot specified

UniProt P61995

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_PYRFU
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain An； PDBConstruct 1–147； UniProt 1–147

Small ribosomal subunit protein uS13

OrganismNot specified

UniProt Q8U0E2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS13_PYRFU
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Ao； PDBConstruct 1–148； UniProt 1–148

Small ribosomal subunit protein uS14

OrganismNot specified

UniProt Q8U013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS14Z_PYRFU
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Ap； PDBConstruct 1–56； UniProt 1–56

Small ribosomal subunit protein uS15

OrganismNot specified

UniProt Q8TZD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS15_PYRFU
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Aq； PDBConstruct 1–158； UniProt 1–158

Small ribosomal subunit protein uS17

OrganismNot specified

UniProt Q8U008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17_PYRFU
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Ar； PDBConstruct 1–113； UniProt 1–113

Small ribosomal subunit protein eS17

OrganismNot specified

UniProt Q8U0U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17E_PYRFU
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain As； PDBConstruct 1–67； UniProt 1–67

Small ribosomal subunit protein uS19

OrganismNot specified

UniProt Q8U002

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19_PYRFU
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain At； PDBConstruct 1–132； UniProt 1–132

Small ribosomal subunit protein eS19

OrganismNot specified

UniProt Q8U0T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U0T4_PYRFU
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain Au； PDBConstruct 1–150； UniProt 1–150

Small ribosomal subunit protein eS24

OrganismNot specified

UniProt Q8U442

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS24_PYRFU
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Av； PDBConstruct 1–99； UniProt 1–99 Author chain Bl； PDBConstruct 1–99； UniProt 1–99

Small ribosomal subunit protein eS27

OrganismNot specified

UniProt Q8U474

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27_PYRFU
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Aw； PDBConstruct 1–63； UniProt 1–63

Small ribosomal subunit protein eS28

OrganismNot specified

UniProt Q8U159

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS28_PYRFU
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Ax； PDBConstruct 1–71； UniProt 1–71

Zn-ribbon RNA-binding protein

OrganismNot specified

UniProt I6U991

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I6U991_9EURY
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain Ay； PDBConstruct 1–60； UniProt 1–60

Large ribosomal subunit protein uL2

OrganismNot specified

UniProt Q8U001

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_PYRFU
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain BA； PDBConstruct 1–239； UniProt 1–239

Large ribosomal subunit protein uL3

OrganismNot specified

UniProt Q8TZZ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_PYRFU
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain BB； PDBConstruct 1–365； UniProt 1–365

Large ribosomal subunit protein uL4

OrganismNot specified

UniProt Q8TZZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_PYRFU
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain BC； PDBConstruct 1–255； UniProt 1–255

Large ribosomal subunit protein uL5

OrganismNot specified

UniProt Q8U012

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_PYRFU
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain BD； PDBConstruct 1–186； UniProt 1–186

Large ribosomal subunit protein uL6

OrganismNot specified

UniProt Q8U015

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_PYRFU
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain BE； PDBConstruct 1–184； UniProt 1–184

Large ribosomal subunit protein eL8

OrganismNot specified

UniProt Q8U160

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_PYRFU
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain BF； PDBConstruct 1–123； UniProt 1–123 Author chain BG； PDBConstruct 1–123； UniProt 1–123

Large ribosomal subunit protein uL16

OrganismNot specified

UniProt Q9UWP5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10E_PYRFU
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain BH； PDBConstruct 1–181； UniProt 1–181

Large ribosomal subunit protein uL13

OrganismNot specified

UniProt Q8U0E6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_PYRFU
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain BI； PDBConstruct 1–142； UniProt 1–142

Large ribosomal subunit protein uL14

OrganismNot specified

UniProt Q8U009

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_PYRFU
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–141； UniProt 1–141

Large ribosomal subunit protein eL14

OrganismNot specified

UniProt Q8U2L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14E_PYRFU
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain BK； PDBConstruct 1–83； UniProt 1–83 Author chain BL； PDBConstruct 1–83； UniProt 1–83

Large ribosomal subunit protein uL15

OrganismNot specified

UniProt Q8U018

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_PYRFU
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain BM； PDBConstruct 1–147； UniProt 1–147

Large ribosomal subunit protein eL15

OrganismNot specified

UniProt Q8U2F9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15E_PYRFU
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain BN； PDBConstruct 1–194； UniProt 1–194

Large ribosomal subunit protein uL18

OrganismNot specified

UniProt Q9HH80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_PYRFU
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain BO； PDBConstruct 1–203； UniProt 1–203

Large ribosomal subunit protein eL18

OrganismNot specified

UniProt Q8U0E5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_PYRFU
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain BP； PDBConstruct 1–120； UniProt 1–120

Large ribosomal subunit protein eL19

OrganismNot specified

UniProt Q8U016

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL19E_PYRFU
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–150； UniProt 1–150

Large ribosomal subunit protein eL21

OrganismNot specified

UniProt Q8U217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_PYRFU
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain BR； PDBConstruct 1–97； UniProt 1–97

Large ribosomal subunit protein uL22

OrganismNot specified

UniProt Q8U003

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_PYRFU
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain BS； PDBConstruct 1–155； UniProt 1–155

Large ribosomal subunit protein uL23

OrganismNot specified

UniProt Q8U000

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_PYRFU
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain BT； PDBConstruct 1–86； UniProt 1–86

Large ribosomal subunit protein uL24

OrganismNot specified

UniProt Q8U010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_PYRFU
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain BU； PDBConstruct 1–121； UniProt 1–121

Large ribosomal subunit protein eL24

OrganismNot specified

UniProt Q8U158

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_PYRFU
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain BV； PDBConstruct 1–66； UniProt 1–66

Large ribosomal subunit protein uL29

OrganismNot specified

UniProt Q8U005

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_PYRFU
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain BW； PDBConstruct 1–72； UniProt 1–72

Large ribosomal subunit protein uL30

OrganismNot specified

UniProt Q9HH78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_PYRFU
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain BX； PDBConstruct 1–155； UniProt 1–155

Large ribosomal subunit protein eL30

OrganismNot specified

UniProt Q8U0M6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30E_PYRFU
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain BY； PDBConstruct 1–99； UniProt 1–99

Large ribosomal subunit protein eL31

OrganismNot specified

UniProt Q8U3S7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_PYRFU
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain BZ； PDBConstruct 1–95； UniProt 1–95

Large ribosomal subunit protein eL32

OrganismNot specified

UniProt Q9HH82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL32_PYRFU
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–130； UniProt 1–130

Large ribosomal subunit protein eL34

OrganismNot specified

UniProt Q8U2L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL34_PYRFU
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–89； UniProt 1–89

Large ribosomal subunit protein eL33

OrganismNot specified

UniProt Q8TZV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL35A_PYRFU
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–87； UniProt 1–87

Large ribosomal subunit protein eL37

OrganismNot specified

UniProt Q8U0P5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_PYRFU
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–62； UniProt 1–62

Large ribosomal subunit protein eL43

OrganismNot specified

UniProt Q8TZI4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37A_PYRFU
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain Be； PDBConstruct 1–83； UniProt 1–83

Large ribosomal subunit protein eL39

OrganismNot specified

UniProt Q8U3S6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_PYRFU
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–51； UniProt 1–51

Large ribosomal subunit protein eL40

OrganismNot specified

UniProt Q8U0V6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL40_PYRFU
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain Bg； PDBConstruct 1–51； UniProt 1–51

Small ribosomal subunit protein eS32

OrganismNot specified

UniProt Q8U232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS32_PYRFU
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain Bh； PDBConstruct 1–37； UniProt 1–37

Large ribosomal subunit protein eL42

OrganismNot specified

UniProt Q8U475

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL44E_PYRFU
Isoform	—
PDB entities	61
Chains and sequence ranges	Author chain Bi； PDBConstruct 1–94； UniProt 1–94

Large ribosomal subunit protein eL20

OrganismNot specified

UniProt Q8U3S9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） C2H2-type domain-containing protein × 1 （Q8U2K5） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18A_PYRFU
Isoform	—
PDB entities	62
Chains and sequence ranges	Author chain Bj； PDBConstruct 1–77； UniProt 1–77

C2H2-type domain-containing protein

OrganismNot specified

UniProt Q8U2K5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 63 RNA 3	16S rRNA × 1 Small ribosomal subunit protein uS2 × 1 （Q8U0F0） Small ribosomal subunit protein uS3 × 1 （Q8U004） Small ribosomal subunit protein eS1 × 1 （Q8TZE1） Small ribosomal subunit protein uS4 × 1 （P61993） Small ribosomal subunit protein eS4 × 1 （Q8U011） Small ribosomal subunit protein uS5 × 1 （Q8U017） Small ribosomal subunit protein eS6 × 1 （Q8U3H8） Small ribosomal subunit protein uS7 × 1 （Q8U0M8） Small ribosomal subunit protein uS8 × 1 （Q8U014） Small ribosomal subunit protein eS8 × 1 （Q8U1Y5） Small ribosomal subunit protein uS9 × 1 （Q8U0E7） Small ribosomal subunit protein uS10 × 1 （P61885） Small ribosomal subunit protein uS11 × 1 （Q8U0E3） Small ribosomal subunit protein uS12 × 1 （P61995） Small ribosomal subunit protein uS13 × 1 （Q8U0E2） Small ribosomal subunit protein uS14 × 1 （Q8U013） Small ribosomal subunit protein uS15 × 1 （Q8TZD9） Small ribosomal subunit protein uS17 × 1 （Q8U008） Small ribosomal subunit protein eS17 × 1 （Q8U0U1） Small ribosomal subunit protein uS19 × 1 （Q8U002） Small ribosomal subunit protein eS19 × 1 （Q8U0T4） Small ribosomal subunit protein eS24 × 2 （Q8U442） Small ribosomal subunit protein eS27 × 1 （Q8U474） Small ribosomal subunit protein eS28 × 1 （Q8U159） Zn-ribbon RNA-binding protein × 1 （I6U991） 23S rRNA × 1 5S rRNA × 1 Large ribosomal subunit protein uL2 × 1 （Q8U001） Large ribosomal subunit protein uL3 × 1 （Q8TZZ8） Large ribosomal subunit protein uL4 × 1 （Q8TZZ9） Large ribosomal subunit protein uL5 × 1 （Q8U012） Large ribosomal subunit protein uL6 × 1 （Q8U015） Large ribosomal subunit protein eL8 × 2 （Q8U160） Large ribosomal subunit protein uL16 × 1 （Q9UWP5） Large ribosomal subunit protein uL13 × 1 （Q8U0E6） Large ribosomal subunit protein uL14 × 1 （Q8U009） Large ribosomal subunit protein eL14 × 2 （Q8U2L5） Large ribosomal subunit protein uL15 × 1 （Q8U018） Large ribosomal subunit protein eL15 × 1 （Q8U2F9） Large ribosomal subunit protein uL18 × 1 （Q9HH80） Large ribosomal subunit protein eL18 × 1 （Q8U0E5） Large ribosomal subunit protein eL19 × 1 （Q8U016） Large ribosomal subunit protein eL21 × 1 （Q8U217） Large ribosomal subunit protein uL22 × 1 （Q8U003） Large ribosomal subunit protein uL23 × 1 （Q8U000） Large ribosomal subunit protein uL24 × 1 （Q8U010） Large ribosomal subunit protein eL24 × 1 （Q8U158） Large ribosomal subunit protein uL29 × 1 （Q8U005） Large ribosomal subunit protein uL30 × 1 （Q9HH78） Large ribosomal subunit protein eL30 × 1 （Q8U0M6） Large ribosomal subunit protein eL31 × 1 （Q8U3S7） Large ribosomal subunit protein eL32 × 1 （Q9HH82） Large ribosomal subunit protein eL34 × 1 （Q8U2L3） Large ribosomal subunit protein eL33 × 1 （Q8TZV6） Large ribosomal subunit protein eL37 × 1 （Q8U0P5） Large ribosomal subunit protein eL43 × 1 （Q8TZI4） Large ribosomal subunit protein eL39 × 1 （Q8U3S6） Large ribosomal subunit protein eL40 × 1 （Q8U0V6） Small ribosomal subunit protein eS32 × 1 （Q8U232） Large ribosomal subunit protein eL42 × 1 （Q8U475） Large ribosomal subunit protein eL20 × 1 （Q8U3S9） ZINC ION × 13 water × 56	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U2K5_PYRFU
Isoform	—
PDB entities	63
Chains and sequence ranges	Author chain Bk； PDBConstruct 1–64； UniProt 1–64

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9qf4
Deposition date deposition_date	2025-03-11
Structure title title	Structure of P. furiosus 70S ribosome grown at 95 degC
Keywords keywords	RNA modification, cryo-EM, ribosome; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9qf4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9qf4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9qf4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	86.83 Å
Rg (electron density)	88.33 Å
Total Rg	88.20 Å
Atom count	163487
Residues	12342
Excluded volume	2561600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9qf4__assembly_1__model_1`	66-meric （66）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (65)

Entity 1 Entity 1 polymer

Description description	16S rRNA
Molecular weight formula_weight	489055.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A1
Atom count atom_count	165982

AUUCNGGUUGAUCCUGCCGGAGGCCACUGCUAUGGGGGUCNGACUAAGCCAUGCGAGUCAAGGGGGCGUCCCUUCUGGGACGCCACNGGCGGACGGCUCAGUAACACGUCGGUAACCUACCCUCGGGAGGGGGAUAACCCNGGGAAACUGGGGCUAAUCCCCCAUAGGCCUGGGGUACUGGAAGGUCCCCAGGCCGAAAGGGAGCCGUAAGGCUCNGCCNGAGGAUGGGCNGGCGGCCGAUUAGGUAGUUGGUGGGGUAACGGCCCACCAAGCNGAAGAUCGGUACGGGCNGUGAGAGCGGGAGCCNGGAGAUGGACACUGAGACACGGGUCCAGGCCCUACGGGGCGCAGCAGGCGCGAAACCUCNGCAAUGCGGGAAACNGCGACGGGGGGACCCCCAGUGCNGUGCCUCUGGCACGGCUUUUCNGGAGUGUAAAAAGCUCNGGGAAUAAGGGCUGGGCAAGGCNGGUGGCAGCCGCCGCGGUAAUACCGGCGGCCNGAGUGGUGGCCACUAUUAUUGGGCCUAAAGCGGCNGUAGCNGGGCCNGUAAGUCCCUGGCGAAAUCCCACGGCUCAACNGUGGGGCUCGCUGGGGAUACUGCGGGCCUUGGGACNGGGAGAGGCNGGGGGUACCCCNGGGGUAGGGGUGAAAUCCUAUAAUCCCGGGGGGACCGCCAGUGGCGAAGGCGCCCGGCUGGAACGGGUCNGACGGUGAGGGCNGAAGGCCAGGGGAGCGAACNGGAUUAGAUACCCGGGUAGUCCUGGCUGUAAAGGAUGCGGGCUAGGUGUCGGGCGAGCUUCGAGCUCGCCCGGUGCNGUAGGGAAGCNGUUAAGCCNGCNGCCUGGGGAGUACGGCNGCAAGGCUGAAACUUAAAGGAAUUGGCGGGGGAGCACUACAAGGGGUGGAGCGUGCGGUUUAAUUGGAUUCAACGCCGGGAACCUCACNGGGGGCGACGGCAGGAUGAAGGCCAGGCUGAAGGUCUUGCCGGACGCGCCGAGAGGAGGUGCAUGGCCGCNGUCAGCUCGUACCGUGAGGCGUCCACUUAAGUGUGGUAACGAGCGAGACCNGCGCCCCCAGUUGCCAGUCCCUCCCGCUCGGGAGGGAGGCACUCUGGGGGGACUGCCGGCGAUAAGCNGGAGGAAGGGGCGGGCGACGGUAGGUCAGUAUGCCCCGAAACCCCNGGGCUACACGCGCGCUACAAUGGGCGGGACAAUGGGACCNGACCCNGAAAGGGGAAGGGAAUCCCCUAAACCNGCCCUCAGUUCGGAUCGCGGGCUGCAACUCGCCNGCGUGAAGCUGGAAUCCCUAGUACCNGCGUGUCAUCAUCGCGCGGCGAAUACGUCCCUGCUCCUUGCACACACCGCCCGUCACUCCACCCGAGCGGAGUCCGGGUGAGGCCUGAUCUCCUUCGGGAGGUCAGGUCGAGCCCGGGCUCCGUGAGGGGGGAGAAGUCGUAACAAGGUAGCNGUAGGGGAACCUACGGCUCGAUCACCUCCU

Entity 2 Entity 2 polymer

Description description	Small ribosomal subunit protein uS2
Molecular weight formula_weight	23039.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa

MADEYLVPLDQYLAAGVHIGTQQKTKDMKKFIYRVRQDGLYVLDVRKTDERLKVAGKFLAKFEPQSILAVSVRLYGQKPVKKFGEVTGARAIPGRFLPGTMTNPAVKNFFEPDVLIVTDPRADHQAMREAVEIGIPIVALVDTENLLSYVDLAIPTNNKGRKALALIYWILAREILYNRGEIQSREDFKIPVEEFEMKIVRR

Entity 3 Entity 3 polymer

Description description	Small ribosomal subunit protein uS3
Molecular weight formula_weight	23464.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab

MAIERYFIREAVREMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILEKQFGLENPQIEVEEIKNPYLNAKVQAVRLAQALERGIHFRRAAYAALRAIMNNGARGVEIRLSGKLTGERAKSIRFYQGYLAKVGNPAETLVSKGYAQALLKLGVIGVKVAIMPPGARLPDEIEIIEKPVEEEVVSNEAE

Entity 4 Entity 4 polymer

Description description	Small ribosomal subunit protein eS1
Molecular weight formula_weight	22984.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ac

MAAKRATTTRDKWKLKQWYIIYAPDFFGGVEVGLTPADDPEKVLNRVVEVTLKDVTGDFTKSHVKLYFQVYDVKGQNAYTKFKGMKLARSYIRSLVRRKTTRIDGIFNITTKDGYKLRVMAMAIAMRRIQTSQERAIRKIMQEIIYKKAEELNFKDFVLESVNGKIAAEIAKEAKKIYPLRKAEIRKIKVLEEPQVIA

Entity 5 Entity 5 polymer

Description description	Small ribosomal subunit protein uS4
Molecular weight formula_weight	21381.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad

MGDPKRQRKKYETPPHPWIKERLDRERVLMDKYELKNKKELWKHETQLKNFRRRARRLLAARGKQAEIEREQLLARLKRLGLLPEDAVLDDVLSLTIEDILERRLQTIVYKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTITYARTSPFANPQHPERMMIEKAKQGGEA

Entity 6 Entity 6 polymer

Description description	Small ribosomal subunit protein eS4
Molecular weight formula_weight	28197.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ae

MARKGPKRHLKRLAAPTSWYIERKAYKWAVRPRPGPHNMRTSIPLLYIVRDYLGYAKTAREARKILNEGKFLVDGRVRKDYKFPVGIMDVVSIPETGEHYRVLPNRIGKLILHPISEDEAFIKPLRIRNKRMIKGARVQLNFHDGTNHIVSIAEKDNYFTSYTVLMKVPEREILEVLPFEKGAYVFVTQGKNVARKGRIVEIKRFPMGWPDVVTIEDEEGELFDTLKEYAFVVGTDKPKISLP

Entity 7 Entity 7 polymer

Description description	Small ribosomal subunit protein uS5
Molecular weight formula_weight	26590.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Af

MSQEWKEYAKRVLDEWEPKTKLGMMVKEGQITDIHEIFRRGYQIKEPEIIDVLLPEVNARENQEVLDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGHGKEVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFAVEGKEGSVRVRLIPGPRGLGLVIGDVGKKILRLAGVQDVWSQTFGETRTTVNFAKAVFNALYNTNRVAISPEMIERYGIVVGRAMPTTFTLE

Entity 8 Entity 8 polymer

Description description	Small ribosomal subunit protein eS6
Molecular weight formula_weight	14002.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ag

MATFKLVISDPKSGIAKQVEITGAETEKLIGKRIGDQIPAKELNINLNELFGKEFPEDVKLEIRGGTDKDGFPMRPDIHGPRRVRVLLSKGPGFRPKEKGERRKKTVRGNTISPEIVQVNVKLVY

Entity 9 Entity 9 polymer

Description description	Small ribosomal subunit protein uS7
Molecular weight formula_weight	24701.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ah

MAKPLNERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRHAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAYEVVKEAFKIIEQRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVDISPMRRLDVALRNIALGASAKCYRNKMSFAEALAEEIILAANKDPKSYAYSKKLEIERIAESSR

Entity 10 Entity 10 polymer

Description description	Small ribosomal subunit protein uS8
Molecular weight formula_weight	14684.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ai

MTLLDPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQLLGRINKAGAIKPRFPVKVSEFEKWEKRFLPAFEFGILIVSTSQGVMSHKEAIEKGIGGRLIAYVY

Entity 11 Entity 11 polymer

Description description	Small ribosomal subunit protein eS8
Molecular weight formula_weight	14293.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aj

MAIWQGRSLKKPSGGRIVLARKKRKRELGREPSNTRVAEQDKRKIIRTYGGNRKVRLTAAAYANVFDKSGKGRKVRIIRVIENPANRQFARRNIITKGAIIETEIGKAKVTSRPGQDGVVNAILLEE

Entity 12 Entity 12 polymer

Description description	Small ribosomal subunit protein uS9
Molecular weight formula_weight	15317.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ak

MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSVDIDVKVEGGGFMGQAEAARMAIARALVEWTGDMSLKEKFMKYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

Entity 13 Entity 13 polymer

Description description	Small ribosomal subunit protein uS10
Molecular weight formula_weight	11769.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Al

MQKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGSATFDRWELRVHKRLIDIEADERAMRQIMRIRVPEDVTIEIELIS

Entity 14 Entity 14 polymer

Description description	Small ribosomal subunit protein uS11
Molecular weight formula_weight	14757.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Am

MSEEQVNIKKKEKWGIAHIYSSFNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV

Entity 15 Entity 15 polymer

Description description	Small ribosomal subunit protein uS12
Molecular weight formula_weight	16477.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	An

MPGKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR

Entity 16 Entity 16 polymer

Description description	Small ribosomal subunit protein uS13
Molecular weight formula_weight	16948.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ao

MANFRHIVRVAGVDLDGNKQLRWALTAIKGIGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILADPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSRKKK

Entity 17 Entity 17 polymer

Description description	Small ribosomal subunit protein uS14
Molecular weight formula_weight	6634.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ap

MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIQGLMLCRHCFREVAPKLGFRKYE

Entity 18 Entity 18 polymer

Description description	Small ribosomal subunit protein uS15
Molecular weight formula_weight	18640.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aq

MARMHARKRGKSGSKRPPRTAPPIWVEYTVEEIENLVVKLRKEGYSTAMIGTILRDQYGIPSVKLFKDPDNPNRNLTITRILEKHGLAPEIPEDLMFLIRRAVNLRKHLEQHPKDLHSMRGLQLIESKIRRLVKYYKRKGKLPKNWRYDPETAKLLVR

Entity 19 Entity 19 polymer

Description description	Small ribosomal subunit protein uS17
Molecular weight formula_weight	13296.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ar

MMRDIGLRVQPPAEKCDDPKCPWHGNLKIHGRVFEGIVVSDKPRKTVTVERQYYFYLNKYERYELRRSKIHAHNPPCINAKVGDKVLIAETRPLSKTKHFVVVAVLERAEERR

Entity 20 Entity 20 polymer

Description description	Small ribosomal subunit protein eS17
Molecular weight formula_weight	7942.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	As

MGKIRQGFIKRVARELVNKYPNEFTTDFEHNKKKVQELTNVTSKKIRNRIAGYVTKLVRMKMEGKIL

Entity 21 Entity 21 polymer

Description description	Small ribosomal subunit protein uS19
Molecular weight formula_weight	15357.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	At

MARKEFRYRGYTLEQLMNMSLEELARLFPARQRRSLKRGLTPEQKKLLRKIRLAKKGKYKKPIRTHCRDMIILPEMVGLTIYVHNGKEFVPVEIKPEMIGHYLGEFAPTRKKVEHGAPGVGATRSSMFVAVK

Entity 22 Entity 22 polymer

Description description	Small ribosomal subunit protein eS19
Molecular weight formula_weight	17394.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Au

MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPEKFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY

Entity 23 Entity 23 polymer

Description description	Small ribosomal subunit protein eS24
Molecular weight formula_weight	11698.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Av,Bl

MEIRIKEIKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYISKGYAKAYDSKERMLYIEPEYILIRDGLIEKKEGE

Entity 24 Entity 24 polymer

Description description	Small ribosomal subunit protein eS27
Molecular weight formula_weight	6888.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aw

MAKPIIPMPRSRFLRVKCIDCGNEQIVFSHPATKVRCLICGATLVEPTGGKGIVKAKILEVLE

Entity 25 Entity 25 polymer

Description description	Small ribosomal subunit protein eS28
Molecular weight formula_weight	8116.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ax

MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNVRGPVRIGDILILRETEREAREIKSRR

Entity 26 Entity 26 polymer

Description description	Zn-ribbon RNA-binding protein
Molecular weight formula_weight	6824.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ay

MVEMKFEIPVCTSCGREITPREHATHFICPNCGEAVIWRCESCRVLAKPYKCPNCGWEGP

Entity 27 Entity 27 polymer

Description description	23S rRNA
Molecular weight formula_weight	997558.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B1

GGGGCUAGGACGCUAAGCNGCCNGGUGGAUGGCUCGGCUCGGGGCGCNGACGAAGGGCGUGGCAAGCUGCGAUAAGCCCNGGCGAGGCGCAGGCAGCNGUCGAACNGGGGAUUCCNGAAUGGGACCUCCNGCGGCUUAUGCNGCACUCCGGGGUUUAUCCCNGGAGGGGGAACGCGGGGAAUUGAAACAUCUUAGUACCNGCAGGAAAAGAAAGCAAAAGCGAUGCNGUGAGUAGGGGCGACNGAAAACGGCAGAGGGCAAACUGAACCCNGGGCCGACGAGGUUCGGGGGAUGUGGGGUUGUAGGGCCCCCGUAUGAGACCCUCGCGGGUGAAGCNGAAGUCNGCUGGAACGCGGCGCNGGAGAGGGUGAUAGCCCNGUAGGCGUAAGCCCGCAGGGUCUCGGGGGACCCUGAGUACNGUCGGUUGGAUAUCNGGCGGGAAGCUGGGAGGCAUCGGCUCCCAACCCUAAAUACGUCCCGAGACNGAUAGCGAACUAGUACCGUGAGGGAAAGCUGAAAAGCACCCCGGGAGGGGGGUGAAAAGAGCCUGAAACCGGGCGGCGAUAGGAGGGUGCGGCCNGAAAGGAAUGAGCCUCCCNGAAGGAAACNGCGGCGACGCGGGAGUACGAGGGGAGGGGACNGGGGUUGCACNGUCCGUCUUGAAACACGGGGCAGGGAGUUCGCGGCNGUGGCGAGGUUAAGGGGGUUAAGCCCNGUAGCNGCAGGGAAACNGACAUGCCCGCAGCCGGGCUUAUGCCCGGUGAGGGGCGGGGUGCGAAAGCGCCNGGAGUCACGGCCGCGAGACCNGAAACNGGUCGAUCUAGCCNGGGGCAGGGUGAAGUCCCUCAACCGAGGGAUGGAGGCCNGCUAGGGGUGCUGAUGUGCAGUUCGCUCCNGUGACCCCGGGCUAGGGGUGAAAGGCCAAUCGAGGCNGGAGAUAGCUGGUUCCNGCNGAAUCAUCCCGCAGGAUGGCCUCCCNGGAGGUAGGCGGUGGGGUAGAGCACUGAUUGGAGGUGCAGGGGGCGAAAGCCCCCGGCCUCCUGUCAAACUCNGAACCCACNGCNGCNGUAGAUGGGGGGAGUAGGGUGGCGGUGUAAGCNGUCCACNGAGAGGGGAACAACCCAGACNGGGGUUAAGGCCCCAAAGUGCNGGCUAAGUGUUACUCCAAAGGGUGUCCNGGGCCUUAGACAGCGGGGAGGUAGGCUUAGAAGCAGCCAUCCUUUAAAGAGUGCGUAACAGCUCACCCGUCGAGGUCCGGGGCCCNGAAAAUGGACGGGGCUCAAGCNGGCNGCNGAGACCCNGGCGCACGGACNGAUUGGUCNGUGAUCGGGUAGGCGGGCGUGCNGGUGGCGUAGAAGCCGGGCCGUAAGGUCNGGUGGAGCNGCCGGUAUCGCGGAUCCUGCCGGGAGUAGCAGCGUAGUCGGGUGAGAAUCCNGACNGCNGGAGGGGCCAGGGUUCCACGGCAAUGGUCGUCAGCNGUGGGUUAGUCGGUCCUAACCCNGCCNGUAACUCGGCGCGGGGGAAAGGGAAACGGGUUUAUAUUCCNGUACNGCGGGGGUAGGUGCGGCAACGCAAGCCNGGAGGGUGACGCCUCGGGGUAGGCGGACNGGCCGAUGAGGCCGGCUAAGCGUAUAAGCCNGGGGAGUGCNGUAAUGGCGAGAACNGGGUGAAAGCGCGAAUGGCCCCCCCGUUAGGGGGGUUCCGCNGAUCCCUGGGGCCCGUGAAAAGCCCUCCGGGAAUUCNGAUCCCCNGCGACNGUACNGAGAACNGACACAGGUGCCCCUGGGUGAGAAGCCUAAGGCGUGUCGGGGGAAACCNGGCNGAGGGAACUCGGCAAACUGGCCCNGUAACUUCGGGAGAAGGGGUGCCUGCGGGUGCGUAACCNGCAGGUCGCAGUGACUAGGGGGGCCNGACUGUUUAAUAAAAACACAGGUCCCAGCUAGCCCGAAAGGGUUUGUACUGGGGCNGACGCCUGCCCAGUGCCGGUAUGUGAAGCCCGGGUACAACNGGGUGAAGCACNGGUAAACGGCGGGGGUAACUAUAACCCUCUUAAGGUAGCGAAAUUCCUUGUCGGUUAAAUGCNGACCUGCAUGAAUGGCGUAACGAGGUCCCNGCUGUCCCCGGCCGGGGCCNGGCGAAACCUCUGCCUGGCGCGCAUGCCAGGGACCCCNGGUGGGAAGCGAAGACCCCAUGGAGCUUUACUGCAGCCUGCNGUUGCCACACGGCGGGGGGUGCGCAGCGUAGGCGGGAGGCGUCGAAGCCCGGCCUCCGGGUCGGGUGGAGCCGUCCAUGAGACACCGCCCACUCCCCGCUGUGUGGCUAACCCCCGAAAGGGGGGACAGCGGUAGGUGGGCAGUUUGGCUGGGGCGGCACGCCUCNGAAAAGGUAUCGGAGGCGCCCUAAGGUCGGCUCAGGCGGGUCAGGAAUCNGCNGUAGAGUGCAAGGGCAAAAGCNGGCCUGACUGGACCNGUAACAGAGGCGGGUCCAGCCCNGAAAGGGUGGCCUAGCGAACCCCUGUGCCUCCCNGGUGGGGGCCAGGGAUGACAGAAAAGCUACCCUGGGGAUAACAGAGUCGUCUCGGGCGAGAGCCCAUAUCGACCCNGAGGCUUGCUACCUCGCUGUCGGCUCUUCCCAUCCUGGCCCUGCAGCAGGGGCCAAGGGUGGGGGUGUUCACCCAUUAAAGGGGAACGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGAUGCUAUCUACCGGGGGUGUUGGCNGCCUGAGGGGAAGGUGCCCCUAGUACGAGAGGAACAGGGUGCNGCGGCCUCUGGUCUACNGGUUGUCCUCCNGGGCAUCGCCGGGCAGCUACGCNGCAGCNGAUAAGGCCUGAAAGCAUCUAAGGCNGAAGCGGCCCCNGAAAAUAGGCGGCNGUUCCCUGGCGCUUGGGCCUGGGCGACCGGCCCAUUGCCAGGGACGAGGGCUCGGGUAGAAGACCCGGUUGAUAGGGCGGGGAUGUAAGCGGGAAGGGUCAACNGACCNGCUUAGUCNGCNGCCCCUAAUCGCCNGAGGUCCUGCCCCU

Entity 28 Entity 28 polymer

Description description	5S rRNA
Molecular weight formula_weight	40673.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B2

GGUACGGCGGCCAUAGCGGGGGGGCCACACCNGGUCUCAUUUCGAACCCGGAAGUUAAGCCCCCCAGCGAUCCCGGUUGUACUGCCCUCNGAGAGGGGGCGGGAAGCNGGGGACGCNGCNGGCCA

Entity 29 Entity 29 polymer

Description description	Large ribosomal subunit protein uL2
Molecular weight formula_weight	26085.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA

MGKSLIQQRRGKGSPTFKSPSHRFRGAVKYIPLNYTQEKTLRGVVEEIMHDPGRTAPVARVKFENGIEKLIIAPEGLLVGQEIYIGPDAPIAVGNTLPLAKIPEGTYVYNIEGIPGDGGKYVRAGGTYALVVSREPDKVIVQLPSGELKAFNPMCRATIGVVAGGGRLEKPLVKAGKAYYKYKARNKFWPTPRGVKMNAVNHPFGGKEHHPGKPTTTSRRAPPGRKVGHIAARRTGRRK

Entity 30 Entity 30 polymer

Description description	Large ribosomal subunit protein uL3
Molecular weight formula_weight	41466.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BB

MGKVHRPRRGSLGFSPRKRAKSIVPRIRSWPKETEVRMLGFAGYKAGMTHILMIDDEPGLTNGKEIFMPVTIIETPPLRVFGIRAYRMGYLGLETATEVIVPDFPLDNYPAKERKGKPKPKMTFYKLLERRIATLPKNYTQEMFEQKLGQLEDMIKEGEIVDVRAIVATQPWVIKLKKKPEVMEYAIGGTSVEEKFNYIKEKLGKELRVGEVLKEGELLDVIAVTKGKGTQGPVKRWGIKLRAHKDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGENGKLKLDENTEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRPQITYVSVESKQ

Entity 31 Entity 31 polymer

Description description	Large ribosomal subunit protein uL4
Molecular weight formula_weight	28765.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC

MKVKVFDLNGQPVGEIELPKVFFTPFRPDLIRRAVIASWTHRIQPQGRDPMAGKRRVTENIGKGHSMARVERLKTPPRYAAFVPFARGGRRTHPPKVEKIIWEDINKKEKRLALMSAIAATANYDLVRARGHIIDNVPQLPLIVVDDLQKVQKTRETREIFKKLGIWDDIVRAKEKSGVRAGKGKMRGRRYKKAKGPLIVVGKNEGIVLGARNHPGVDVVVVDNLGVEHLAPGTHPGRLTVWTVSAIERLRELYG

Entity 32 Entity 32 polymer

Description description	Large ribosomal subunit protein uL5
Molecular weight formula_weight	21269.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

MAVEIPNKEQILADWEAHPMRRPRIEKVTINIGVGESGERLTKAEIMLQQLTGQKPIRRKAKKTNRDFGIRRGEPIAVKVTLRGPKAYELLKRLLAAVDNRLKASSFDEHGNVCFGIEEHINIPGVEYDPEIGIFGMDVCVTLERPGFRVARRKRKRAKIPTRHKLTKEEGMVYMMEEFGVEIVEG

Entity 33 Entity 33 polymer

Description description	Large ribosomal subunit protein uL6
Molecular weight formula_weight	20891.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

MPVDAWIREEVEIPEGVEVTVEGYKVKVKGPKGELEREFFWPGIQIFTEDGNVVIYKDFPRRKDVAIARTFAAHIRNMIKGVTEGFTYKLKVVYSHFPISVKVQGDEVIIENFLGEKAPRKAKILPGVTVKVRGQEIIVEGIDKEAVGQTAANIEQATRITKWDRRIFQDGIYIVEKAGKPITF

Entity 34 Entity 34 polymer

Description description	Large ribosomal subunit protein eL8
Molecular weight formula_weight	13414.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF,BG

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK

Entity 35 Entity 35 polymer

Description description	Large ribosomal subunit protein uL16
Molecular weight formula_weight	20974.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BH

MALRPAKIDRYVDKPAYTRREYIRGAPGPKITIFDMGNPAGDFEFEVSLHTAEPVQIRQNALEAARQQVNRYLQKNVGRSNYHFKIRVYPFQVLRENPMATGRKADRYGNGMRRPFGKPIGLAARLKKDQKILSIRVNRQHLKFAIEGARRAAMKFPCKCYYRIYDKEGNDVTTKILSQSL

Entity 36 Entity 36 polymer

Description description	Large ribosomal subunit protein uL13
Molecular weight formula_weight	16345.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

MRIINAEGLILGRLASKVAKMLLEGEEVVIVNAEKAVITGNRDVIFKKYKQRTELRTLTNPRRGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFKRLKVYVGIPKEFQGKELETIIEAHVSRLSRPKYVTVGEVAKFLGGKF

Entity 37 Entity 37 polymer

Description description	Large ribosomal subunit protein uL14
Molecular weight formula_weight	15264.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MAKKGAGATRGVSAVRPTRALPVGAYLTVADNSGAKVIQIIGVVEYHGTRRRLASAGVGDMVVATVKKGRPDMRHQVVRAVIIRQRKEYRRLDGMRVKFEDNAAVIVTPEGVPRGTEIRGPVAREAAERWVRIGSIASIIV

Entity 38 Entity 38 polymer

Description description	Large ribosomal subunit protein eL14
Molecular weight formula_weight	8979.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK,BL

MPAIDVGRIAVVIAGRRAGQKVVVVDIIDKNFVLVTGAGLNKVKRRRMNIKHIEPLPQKIDIPRGASDEEVRAALEKAGISLA

Entity 39 Entity 39 polymer

Description description	Large ribosomal subunit protein uL15
Molecular weight formula_weight	16439.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BM

MIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHLGKRGFSRPPEVQREVRVVNLKFIDEHLDELMQMGIAYEEGGKIIVDVTQFADKVLGTGKLTRPLVIKARAFSPKAEEKIKAAGGEAVLV

Entity 40 Entity 40 polymer

Description description	Large ribosomal subunit protein eL15
Molecular weight formula_weight	22644.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

MGMYKYIREAWKSPKKSYVGELLKQRMIKWRREPVVVRIERPTRLDRARALGYQAKQGYVIVRVRVRKGGRKRPRWKGGRKPSKMGQVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIALKHHKGRVFRGLTSAGKKGRGLRNKGKGAEKVRPSIRANEGKGK

Entity 41 Entity 41 polymer

Description description	Large ribosomal subunit protein uL18
Molecular weight formula_weight	23233.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MAHGPRYRVPFRRRREGKTNYRKRLKLLKSGKPRLVVRKSLNHHIAQIIVYDPKGDRTLVSAHTRELIRDFGWKGHCGNTPSAYLLGLLIGYKAKQAGIEEAILDIGLHPPVRGSSVFAVLKGAVDAGLNVPHSPEIFPDEYRIRGEHIAEYAKMLKEQDEEKFRRQFGGYLVKGLDPEKLPEHFEEVKARIIEKFEGEGARE

Entity 42 Entity 42 polymer

Description description	Large ribosomal subunit protein eL18
Molecular weight formula_weight	13758.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MKRTGPTDPNLRRLIRYLRKKSNEYGVKIWKDVAWRLERPRRQRAEVNVSKINRYANDGEMIVVPGSVLGAGKLEKKVIVAAWKFSETARRKIIEAGGEAITIEELIERNPTGSGVRIME

Entity 43 Entity 43 polymer

Description description	Large ribosomal subunit protein eL19
Molecular weight formula_weight	17920.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MNTLKMQRRIAAEILKCGENRIWIDPERIDDVASAITREDIKRLIKEGVIKKKPIKGQSRYRAKIRHEQKKKGRHRGPGSRKGKKTARMGKKELWIKTIRALRKELRKLKAQKKIDRKTYRMLYIRAKGGQFKNKHQLYLFLEEHGLLKK

Entity 44 Entity 44 polymer

Description description	Large ribosomal subunit protein eL21
Molecular weight formula_weight	11371.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MVQKAHSFRRKTRKKLSKHPRRRGLPPLTRFLQEFEVGQRVHIVIEPSYHKGMPDPRFHGRTGTVVGKRGEAYIVEIKDGSKVKTLFIHPVHLRPQK

Entity 45 Entity 45 polymer

Description description	Large ribosomal subunit protein uL22
Molecular weight formula_weight	17679.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MAKRFGYSFQNFDPKRMARASARDLRISPKLAVEVCRELRGMMLNDALRYLDDVIALKRPVPLKRYNDSQGHKPGKGFGPGRYPVKVAKAIKKVLLNVKNNAVQKGLDPDKLKIIHIAAHKGPVLRGWYPRAFGRATPFNEQTTHIEVVVEEIRR

Entity 46 Entity 46 polymer

Description description	Large ribosomal subunit protein uL23
Molecular weight formula_weight	9893.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MDPYKVIIRPVVTEKAISLIEKENKLTFIVDRRATKQDIKRAVEEIFNVKVEKVNTLITPRGEKKAYVKLKPEYSASEVAARLGLF

Entity 47 Entity 47 polymer

Description description	Large ribosomal subunit protein uL24
Molecular weight formula_weight	14365.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MKISSKQPRKQRKFLYNAPLHVRQKLMSAPLSRELREKYKVRNLPVRVGDKVRIMRGDYKGHEGKVVEVDLKRYRIYVEGATLRKTNGTEVFYPIHPSNVMIIELNLEDEKRKKIIERRAG

Entity 48 Entity 48 polymer

Description description	Large ribosomal subunit protein eL24
Molecular weight formula_weight	7938.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MARWNVCSYCGKPFEPGTGKMYVRNDGRVLFFCSRKCERYYFMGRNPRKLKWTKAYQEARLQRGGE

Entity 49 Entity 49 polymer

Description description	Large ribosomal subunit protein uL29
Molecular weight formula_weight	8549.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MKPSEIREMSIEEIDAKIRELRLQLAKERGLLTMGTSLENPMVIRNLRRDIARLLTIKKEKLREREKGKVKK

Entity 50 Entity 50 polymer

Description description	Large ribosomal subunit protein uL30
Molecular weight formula_weight	17745.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX

MAKLAVIRIRGRVNVKRPVRDTLAMLRLHRVNHCVIVDDTPSYLGMLQKAKDYITWGEINAETLAKLIRKRGRLIGNKPVTDEYVKEKLGMTIEEFAQKVVNGEMSLKDLPNLKPVFRLHPPRGGFRGSKKRSFKEGGALGYRGEKINELIERML

Entity 51 Entity 51 polymer

Description description	Large ribosomal subunit protein eL30
Molecular weight formula_weight	10727.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MDLAFELRKAMETGKVVLGSNETIRLAKTGGAKLIIVAKNAPKEIKDDIYYYAKLSDIPVYEFEGTSVELGTLLGKPFVVASLAIVDPGESKILAIAKR

Entity 52 Entity 52 polymer

Description description	Large ribosomal subunit protein eL31
Molecular weight formula_weight	11083.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BZ

MAIKAGEEVIFTVPIKKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIIDPKVNEKIWERGIEKPPSKLRVKVKVEEEKREGEETVRIAYVTLA

Entity 53 Entity 53 polymer

Description description	Large ribosomal subunit protein eL32
Molecular weight formula_weight	15576.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba

MDEKEFKRLLRVRARLKRKKPRFLRQEWWRYPKFKNDPKWRRPKGIDSKMRLKLKGKPRSPSIGWSSPKLVRGLHPSGYEEVLVHNVKELEALDPKRQAARIAHTVGKKKRIEIIKRAEELGIKVLNPRV

Entity 54 Entity 54 polymer

Description description	Large ribosomal subunit protein eL34
Molecular weight formula_weight	10677.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb

MKPMYRSRSWRRKYVRTPGGRVVIHFERKKPKIAHCAMCGRPLNGIPRGRPVEMRKLPKTKKRPERPMPHLCPRCMRKVMKEQIRAQLS

Entity 55 Entity 55 polymer

Description description	Large ribosomal subunit protein eL33
Molecular weight formula_weight	9755.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc

MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQALGDYVEIV

Entity 56 Entity 56 polymer

Description description	Large ribosomal subunit protein eL37
Molecular weight formula_weight	7245.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MGSGTATFGKRNSTPTHIRCRRCGRVSYNVKKGYCAACGFGRSRRLRKYRWSKKWKKKKNAH

Entity 57 Entity 57 polymer

Description description	Large ribosomal subunit protein eL43
Molecular weight formula_weight	8956.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be

MSGTKKVGSAGRFGARYGLKIRRRVAAVEAKMRQKHTCPVCGRKAVKRISTGIWQCQKCGATFAGGAYLPVTPAGKAVRRITE

Entity 58 Entity 58 polymer

Description description	Large ribosomal subunit protein eL39
Molecular weight formula_weight	6323.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf

MARNKPLAKKLRLAKALKQNRRVPVWVIVKTNRRVLTHPKRRYWRRTKLKE

Entity 59 Entity 59 polymer

Description description	Large ribosomal subunit protein eL40
Molecular weight formula_weight	5858.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bg

MARFPEAEARIFKKYVCLRCGATNPWGAKKCRKCGYKRLRPKAKEPRGGGR

Entity 60 Entity 60 polymer

Description description	Small ribosomal subunit protein eS32
Molecular weight formula_weight	5023.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bh

MKRRPRKWKKKGRMRWKWIKKRIRRLKRQRKKERGLI

Entity 61 Entity 61 polymer

Description description	Large ribosomal subunit protein eL42
Molecular weight formula_weight	11234.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bi

MKYPKQIRTYCPFCKKHTIHKVERVKKRPRSELSAGQRRFRRILKGYGGFPRPKPEGREKPVKKLDLRFRCTECGKAHTRGRGFRVKKFELVEG

Entity 62 Entity 62 polymer

Description description	Large ribosomal subunit protein eL20
Molecular weight formula_weight	9350.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bj

MKVKVFRVHGYFEKNGRKFKFTKEYRGIKEEDVKELVYSDIGSKHKVKRNKIFIKEIKEIRPEEAEDIVVRRLSLEL

Entity 63 Entity 63 polymer

Description description	C2H2-type domain-containing protein
Molecular weight formula_weight	7597.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bk

MVKLKAIIVKDRDGEEFLRCPRCGMVFKRRKDYTKHVNKAHGWLFGRGKPKGKRLQKKYLKASQ

Entity 64 Entity 64 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 65 Entity 65 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2495

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.59 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	169992

Structure of P. furiosus 70S ribosome grown at 95 degC

1. Protein Identity and Related Structures Protein Identity & Related Structures

Small ribosomal subunit protein uS2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein eS1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein eS4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein eS6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein uS8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small ribosomal subunit protein eS8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer