9qgl

Cryo-EM structure of the PlPVC1 baseplate, 6-fold symmetrized (C6), in extended state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phage tail protein

Photorhabdus luminescens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail sheath family protein × 6 （A0A6L9JN00） Phage tail protein × 6 （A0A2S8PZE9） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JSR5_PHOLM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1A； PDBConstruct 1–149； UniProt 1–149 Author chain 1B； PDBConstruct 1–149； UniProt 1–149 Author chain 1C； PDBConstruct 1–149； UniProt 1–149 Author chain 1D； PDBConstruct 1–149； UniProt 1–149 Author chain 1E； PDBConstruct 1–149； UniProt 1–149 Author chain 1F； PDBConstruct 1–149； UniProt 1–149

Phage tail sheath family protein

Photorhabdus luminescens

UniProt A0A6L9JN00

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail protein × 6 （A0A2S8PZE9） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JN00_PHOLM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2A； PDBConstruct 1–354； UniProt 1–354 Author chain 2B； PDBConstruct 1–354； UniProt 1–354 Author chain 2C； PDBConstruct 1–354； UniProt 1–354 Author chain 2D； PDBConstruct 1–354； UniProt 1–354 Author chain 2E； PDBConstruct 1–354； UniProt 1–354 Author chain 2F； PDBConstruct 1–354； UniProt 1–354

Phage tail protein

Photorhabdus luminescens

UniProt A0A2S8PZE9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail sheath family protein × 6 （A0A6L9JN00） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2S8PZE9_PHOLU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 5A； PDBConstruct 1–152； UniProt 1–152 Author chain 5B； PDBConstruct 1–152； UniProt 1–152 Author chain 5C； PDBConstruct 1–152； UniProt 1–152 Author chain 5D； PDBConstruct 1–152； UniProt 1–152 Author chain 5E； PDBConstruct 1–152； UniProt 1–152 Author chain 5F； PDBConstruct 1–152； UniProt 1–152

Contractile injection system tube protein N-terminal domain-containing protein

Photorhabdus luminescens

UniProt A0A2S8PZG1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail sheath family protein × 6 （A0A6L9JN00） Phage tail protein × 6 （A0A2S8PZE9） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2S8PZG1_PHOLU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 7A； PDBConstruct 1–227； UniProt 1–227 Author chain 7B； PDBConstruct 1–227； UniProt 1–227 Author chain 7C； PDBConstruct 1–227； UniProt 1–227 Author chain 7D； PDBConstruct 1–227； UniProt 1–227 Author chain 7E； PDBConstruct 1–227； UniProt 1–227 Author chain 7F； PDBConstruct 1–227； UniProt 1–227

Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17

Photorhabdus luminescens

UniProt Q7MB49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail sheath family protein × 6 （A0A6L9JN00） Phage tail protein × 6 （A0A2S8PZE9） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7MB49_PHOLL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 9A； PDBConstruct 1–239； UniProt 1–239 Author chain 9B； PDBConstruct 1–239； UniProt 1–239 Author chain 9C； PDBConstruct 1–239； UniProt 1–239 Author chain 9D； PDBConstruct 1–239； UniProt 1–239 Author chain 9E； PDBConstruct 1–239； UniProt 1–239 Author chain 9F； PDBConstruct 1–239； UniProt 1–239

Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17

Photorhabdus luminescens

UniProt Q7N649

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail sheath family protein × 6 （A0A6L9JN00） Phage tail protein × 6 （A0A2S8PZE9） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7N649_PHOLL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–905； UniProt 1–905 Author chain B； PDBConstruct 1–905； UniProt 1–905 Author chain C； PDBConstruct 1–905； UniProt 1–905 Author chain D； PDBConstruct 1–905； UniProt 1–905 Author chain E； PDBConstruct 1–905； UniProt 1–905 Author chain F； PDBConstruct 1–905； UniProt 1–905

Baseplate protein J-like domain-containing protein

Photorhabdus luminescens

UniProt A0A6L9JN06

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail sheath family protein × 6 （A0A6L9JN00） Phage tail protein × 6 （A0A2S8PZE9） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JN06_PHOLM
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain a； PDBConstruct 1–966； UniProt 1–968 Author chain b； PDBConstruct 1–966； UniProt 1–968 Author chain c； PDBConstruct 1–966； UniProt 1–968 Author chain d； PDBConstruct 1–966； UniProt 1–968 Author chain e； PDBConstruct 1–966； UniProt 1–968 Author chain f； PDBConstruct 1–966； UniProt 1–968

Phage tail sheath family protein

Photorhabdus luminescens

UniProt A0A6L9JMV2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail sheath family protein × 6 （A0A6L9JN00） Phage tail protein × 6 （A0A2S8PZE9） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JMV2_PHOLM
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 3A； PDBConstruct 1–466； UniProt 1–463 Author chain 3B； PDBConstruct 1–466； UniProt 1–463 Author chain 3C； PDBConstruct 1–466； UniProt 1–463 Author chain 3D； PDBConstruct 1–466； UniProt 1–463 Author chain 3E； PDBConstruct 1–466； UniProt 1–463 Author chain 3F； PDBConstruct 1–466； UniProt 1–463

Phage tail sheath family protein

Photorhabdus luminescens

UniProt A0A6L9JN29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Phage tail protein × 6 （A0A6L9JSR5） Phage tail sheath family protein × 6 （A0A6L9JN00） Phage tail protein × 6 （A0A2S8PZE9） Contractile injection system tube protein N-terminal domain-containing protein × 6 （A0A2S8PZG1） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7MB49） Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17 × 6 （Q7N649） Baseplate protein J-like domain-containing protein × 6 （A0A6L9JN06） Phage tail sheath family protein × 6 （A0A6L9JMV2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JN29_PHOLM
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 4A； PDBConstruct 1–392； UniProt 1–392 Author chain 4B； PDBConstruct 1–392； UniProt 1–392 Author chain 4C； PDBConstruct 1–392； UniProt 1–392 Author chain 4D； PDBConstruct 1–392； UniProt 1–392 Author chain 4E； PDBConstruct 1–392； UniProt 1–392 Author chain 4F； PDBConstruct 1–392； UniProt 1–392

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9qgl
Deposition date deposition_date	2025-03-14
Structure title title	Cryo-EM structure of the PlPVC1 baseplate, 6-fold symmetrized (C6), in extended state
Keywords keywords	Contractile injection system, VIRUS LIKE PARTICLE; VIRUS LIKE PARTICLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9qgl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9qgl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9qgl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	101.50 Å
Total Rg	101.60 Å
Atom count	171084
Residues	21576
Excluded volume	3041300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9qgl__assembly_1__model_1`	54-meric （54）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Phage tail protein
Molecular weight formula_weight	16574.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1A,1B,1C,1D,1E,1F
Atom count atom_count	171084

MAITPEQIAVEYPIPTYRFVVSVGDEQIPFNNVSGLDVHYDVIEYKDGIGNYYKMPGQRQSINITLRKGVFPGDTKLFDWINSIQLNQVEKKDIAISLTNEAGTEILMTWNVANAFPTSFTSPSFDATSNEIAVQEIALTADRVTIQAA

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Phage tail sheath family protein
Molecular weight formula_weight	39009.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2A,2B,2C,2D,2E,2F

MTTITTYPGVYIEEDASLSLSVSSSATAVPVFAVAGDNPLISGKPYIRISNWLEYLTLKNEQFDPANTLDISLRAYFINGGGYCYLVQTTDLEKQVPKLDDVTLLVAAGENITTAVSTLCKPGKGLFAIFDGPTTELKSDGTSNSDYDPNPFAAVYYPWLTADWTTTIDIPPSAAIAGVYCSVDSTRGVWKAPANVPIQGGLQPKYPVTDDLQAQYNQGKALNMIRTFPKSGTLVWGARTLEDNDNWRYIPVRRLFNSAERDIKNAMSFAVFEPNSQPTWERVRSAVNNYLYSLWQQGGLAGNKPDDAYFVQIGKDITMTDDDIKQGKMIIKIGMAAVRPAEFIILQFTQNTAQ

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Phage tail protein
Molecular weight formula_weight	17178.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5A,5B,5C,5D,5E,5F

MHNLYTPSVSHRFIASFLFNNIPSPLDIAFQRISGLSRELQTTQYSQGGENARNVWLAEKIQHGSLHLERGVMTVTPLTLMFDRVLRGEKAVYADVVIMLLNENSVPVASWTLSNALPVRWSTGDFDANSNAVLVNSLELRYQDMRWLGVKV

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Contractile injection system tube protein N-terminal domain-containing protein
Molecular weight formula_weight	24840.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7A,7B,7C,7D,7E,7F

MSLIERGLSKLTLTAFKDREGKISVGSLQAMYNPDAIQLDYQTHYQQDESVNHTRKSSHYVSSPPAGLSLVLLFDASMPGNNIPVETQLTTLKALCAVDPSTHVPHFLKIKWGKMRWENKSYFAGRASGLTINYTLFDRDATPLRASATLSLVADESFVIQATEQQLKSPPVTTVSVTDMLTLPLIALGAGASLASGIDYLSLAWQNDLDNLDDFTPGQTLQAQEKA

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17
Molecular weight formula_weight	27145.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9A,9B,9C,9D,9E,9F

MTNKILADIYGRGWAFPPQFFIGERIPYEDYSSDLNKYLSEKKIEAEQIVKIQACIKESVMCYDFHAKITSTQVSKQTNLPNPLNILVTYTLGDSEISQKIQGVLRVSQDDPPQFSIKDNSRTGIAIAEGTQNVLQSINILFLTEPGERIMREDYGCGLNDYLFANISDELMTDIQTHIEERVLRYEPRAEITSIQVNQRTNLPSTLHVQVTYALRGSDINQQIEGVLEVNEGRVQVSL

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17
Molecular weight formula_weight	101454.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F

MGQAELDNKLSAIVPDTVFKLDERSTLDILNWLKAYAEKIPFDQDKNQFWDSFYFIQENTPEELEDIYQHANKADGLLPPHQAFVFAFLKLLETSNRLLNTFPARHRDLYYRELLGLSPRKAQADSVALGITLNTDNAEYLIPKGTLFDAGQDSVGNPLQYTSETDLLANQGELTDLRWYRKDKDSWQSTIPLSLSDNIALPENGIQLFSPTANDVAVLSGYLIKSSLFSMPEGERHITLTLENDWEGQAEHLTAKISTGDHWLSLSVNPNRTNKNTIELELSSTDDPISPPDNLDGMTFDIPVLKLGTTQKPMLPKITGIEININGNRSVRYASDGGIEQTDTTSSPFGQSPSLGSGFNLVAPEWYGTENATLTMTPQWVGLPTSSFSTWYDKYNPKPASNGVFKVQGYLVTSQKRDVLNDAKSQPLFDGTGAPQGQSLTFILPAMHYPLTDSPSPNEWPASVRIELAEQDFMHAQYWQNPTDKNVPYTPQISALQIQFSTTAKPEQFTVYPLTPFGWANTNEDPPSFTNDALYLGFTNVLPGQTLSLYWQLEGFKALNLSWFYLNQSNTWGSLDQLVDDQTHNLFDQGTWRTLLPQDASNQATLMPTGRYWLKAEITHQAESQDYPKIKGILYNAATATLINAELVETDHFINGLPADSITQPVNALVAIDSINQPWVSWNGRPEETEQAFLTRVSARLSHRNRVLSWDNIVTLLKEQFVSLFDVKYPSASELTKIPAQKEQQLIAIPDSRYKDNDDALRPILNPARLAEMVDWISQLSSPWTTLKINNPTYVDVLISYQLVFVTGINPDYGRHQLQQELSRKYMPWAEDSAIGVTTGNRIDYYPLLATIQQSPLVERVTNLTLKKSSQTAGAVGDSVEAADNEVLILVWSENSSTNKGADSE

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Baseplate protein J-like domain-containing protein
Molecular weight formula_weight	110905.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f

MNNQDALFPIVKDDIAFETLLTQAKTVIEQQSGQLWSNTEENDPGITLLEACCYGASDLAYRHSLPLRDLLTPEKQEQTLGDGIFPQEFGPQQMLTCGPITAEDYRRALLDLHSSDTDNETSEDYFFFNDVRLICEPESERYKYWYNKESREYSFIQEQEQEQEQLQLTLRGNYWLYLLPNRETEDDKTLTQKRLNDFLKDNRNLGESVSKIIWLQPVDFLLQLDIELDDDVSDLADIFAQVYMTTEQMVLTSPLRYSTQAMIEQGYSNEEIFEGPYLHHGWIPELSAAKDYTKPTELKLSHLANRLLAIPGVQNITRLALGKHDENISPLADDSWSWTIAQGYYPRLWGNDPLDLISSSASPLTITAKGGVKITVSKQDIENKIIAEPLIETQPELLNWGKHRKVLDYYPVSNKLPACYGLQTYAETQQQVHLHQFMLPFEQMLANGCAELALLPKLLAFKQRGNTVYGTQWPFKANTVGQQVHQEIMPDLIKQLNNDSQINSDDGIHSQNYTKELSILNYLLEYFGTHRAARPLTLDSLDFLSTQRGYLAQQPELTYQRNNIRIDKVSALQKRIAARLGLGGKCFEETSKLDELPFYLIEHRQLLPVKPDTKFDKEQKPDKLKIKSVPNSKNQQLIITQNGTTGQLLYGQVINLIIKEKENQDIRVKFILRGQMITDITGESFILDTRNSTALARSLIDVQNAYNDGNLYWCNSPVWMEDMDYQLVYASEIYQTGTENERWITSSPQSPFPAMIEENDEITLKYVITPSGPKKSDHELKANVIKFDRIQGKILIKLTQDSQDNFPLAADAWRYRWYFSSEKYALADRFSFVVSMVINSQLVKNDDVDPYKLESWAKTEILAEFPAHLSMIIHWLSPEDFKDFVSTYQRWQNNGAPLGDEAYHVLETLTLGRLPSAATGIGNMRIATAQQRIGVVGESGKEWNTEVIISNQLVYVPYTGENLNKR

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Phage tail sheath family protein
Molecular weight formula_weight	51330.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3A,3B,3C,3D,3E,3F

MPTIPTYPGVYIEEDASLNLSVNQGNTAIPVFIGLFSPKNTNLKSQVTRVNSWLDFTNLFNAGCIAPITIKSTKRASMPAPTLLENVKGDTAVVATPGISVDADNKDPTYTYKVIVNYTTSSDALKLYFQNGGGPCYILPQLDRLTQGFLDSIPELIKQALEITLIVCPEWDSGYQSKIYNSLTSSLLNAGYFLIADNQDKNTALITEVASQTATYYPAVKVSQLIQAEDSQIAVSGYEDAKTKSDEVKNLAQLKEKNPTVYQQAVQKIQAIQDEIAANGNIIPVSAVMAGIYCATDASRGVWKAPANIVLSGISDVAERLTDDEQGEMNSKGINAIRYFSHKGFVVWGARTLQNDDNWRYIPVRRLFNAAERDIKQAMQSVVFEPNSQPTWERVKSAIDNYLYSLWQQGALAGNKPQEAYFVQIGKDVTMSDDDIKQGKMIVKVGMAAVRPAEFIILQFSQQVAQ

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	Phage tail sheath family protein
Molecular weight formula_weight	44076.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4A,4B,4C,4D,4E,4F

MEITQPSVTITENLIFPKQNDSFIGIPVFIGYTSSPVDKTAIKLHSLADFARSFPESGLMYYSVRHFFENGGQQAYVLSLGTEQQLSDFSSLITALQQAWLAQTIAAENDITLIITPDVIRFDQTEISDTQRDLWLQLWQSVLNLCKSRRGIMGLLDAPDDPTLAAKCLQQFSSADRQWGVVYWPLLKSAYQDNTQNPIVLSPTAAVAAVIQRNDNQQGVWTAPANIALSKVISPVRAYIEANALFNPDGTSLNLVRSFPGKGIRIWGCRTLENTHDSPWSYIQTRRLVSYIEAYMTQLGRAFVFEPNNAITWMKFKGQAHNWLRQLWLKGGLRGTQEDQAFEVLLGVDESMREADLRAGKMIIKIRLAVLIPAEFIELNLTFDTRTGTIPS

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.68 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	53537

Cryo-EM structure of the PlPVC1 baseplate, 6-fold symmetrized (C6), in extended state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phage tail protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Contractile injection system tube protein N-terminal domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 6/17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate protein J-like domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qgl__assembly_1__model_1

9qgl__assembly_1__model_1 | I(q)

9qgl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment