SAXSdb — 9qgp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phage tail sheath family protein

Photorhabdus luminescens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Phage tail sheath family protein × 6 （A0A6L9JMV2） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JN00_PHOLM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 2A； PDBConstruct 1–354； UniProt 1–354 Author chain 2B； PDBConstruct 1–354； UniProt 1–354 Author chain 2C； PDBConstruct 1–354； UniProt 1–354 Author chain 2D； PDBConstruct 1–354； UniProt 1–354 Author chain 2E； PDBConstruct 1–354； UniProt 1–354 Author chain 2F； PDBConstruct 1–354； UniProt 1–354 Author chain 2G； PDBConstruct 1–354； UniProt 1–354 Author chain 2H； PDBConstruct 1–354； UniProt 1–354 Author chain 2I； PDBConstruct 1–354； UniProt 1–354 Author chain 2J； PDBConstruct 1–354； UniProt 1–354 Author chain 2K； PDBConstruct 1–354； UniProt 1–354 Author chain 2L； PDBConstruct 1–354； UniProt 1–354

Phage tail sheath family protein

Photorhabdus luminescens

UniProt A0A6L9JMV2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Phage tail sheath family protein × 12 （A0A6L9JN00） Phage tail sheath family protein × 6 （A0A6L9JN29）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JMV2_PHOLM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 3A； PDBConstruct 1–466； UniProt 1–463 Author chain 3B； PDBConstruct 1–466； UniProt 1–463 Author chain 3C； PDBConstruct 1–466； UniProt 1–463 Author chain 3D； PDBConstruct 1–466； UniProt 1–463 Author chain 3E； PDBConstruct 1–466； UniProt 1–463 Author chain 3F； PDBConstruct 1–466； UniProt 1–463

Phage tail sheath family protein

Photorhabdus luminescens

UniProt A0A6L9JN29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Phage tail sheath family protein × 12 （A0A6L9JN00） Phage tail sheath family protein × 6 （A0A6L9JMV2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6L9JN29_PHOLM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4A； PDBConstruct 1–392； UniProt 1–392 Author chain 4B； PDBConstruct 1–392； UniProt 1–392 Author chain 4C； PDBConstruct 1–392； UniProt 1–392 Author chain 4D； PDBConstruct 1–392； UniProt 1–392 Author chain 4E； PDBConstruct 1–392； UniProt 1–392 Author chain 4F； PDBConstruct 1–392； UniProt 1–392

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9qgp
Deposition date deposition_date	2025-03-14
Structure title title	Cryo-EM structure of the PlPVC1 sheath, 6-fold symmetrized (C6), in contracted state
Keywords keywords	contractile injection system, VIRUS LIKE PARTICLE; VIRUS LIKE PARTICLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9qgp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9qgp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9qgp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	88.00 Å
Rg (electron density)	87.55 Å
Total Rg	87.67 Å
Atom count	67578
Residues	8646
Excluded volume	1205200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9qgp__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Phage tail sheath family protein
Molecular weight formula_weight	39009.8 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2A,2B,2C,2D,2E,2F,2G,2H,2I,2J,2K,2L
Atom count atom_count	67578

MTTITTYPGVYIEEDASLSLSVSSSATAVPVFAVAGDNPLISGKPYIRISNWLEYLTLKNEQFDPANTLDISLRAYFINGGGYCYLVQTTDLEKQVPKLDDVTLLVAAGENITTAVSTLCKPGKGLFAIFDGPTTELKSDGTSNSDYDPNPFAAVYYPWLTADWTTTIDIPPSAAIAGVYCSVDSTRGVWKAPANVPIQGGLQPKYPVTDDLQAQYNQGKALNMIRTFPKSGTLVWGARTLEDNDNWRYIPVRRLFNSAERDIKNAMSFAVFEPNSQPTWERVRSAVNNYLYSLWQQGGLAGNKPDDAYFVQIGKDITMTDDDIKQGKMIIKIGMAAVRPAEFIILQFTQNTAQ

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Phage tail sheath family protein
Molecular weight formula_weight	51330.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3A,3B,3C,3D,3E,3F

MPTIPTYPGVYIEEDASLNLSVNQGNTAIPVFIGLFSPKNTNLKSQVTRVNSWLDFTNLFNAGCIAPITIKSTKRASMPAPTLLENVKGDTAVVATPGISVDADNKDPTYTYKVIVNYTTSSDALKLYFQNGGGPCYILPQLDRLTQGFLDSIPELIKQALEITLIVCPEWDSGYQSKIYNSLTSSLLNAGYFLIADNQDKNTALITEVASQTATYYPAVKVSQLIQAEDSQIAVSGYEDAKTKSDEVKNLAQLKEKNPTVYQQAVQKIQAIQDEIAANGNIIPVSAVMAGIYCATDASRGVWKAPANIVLSGISDVAERLTDDEQGEMNSKGINAIRYFSHKGFVVWGARTLQNDDNWRYIPVRRLFNAAERDIKQAMQSVVFEPNSQPTWERVKSAIDNYLYSLWQQGALAGNKPQEAYFVQIGKDVTMSDDDIKQGKMIVKVGMAAVRPAEFIILQFSQQVAQ

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Phage tail sheath family protein
Molecular weight formula_weight	44076.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4A,4B,4C,4D,4E,4F

MEITQPSVTITENLIFPKQNDSFIGIPVFIGYTSSPVDKTAIKLHSLADFARSFPESGLMYYSVRHFFENGGQQAYVLSLGTEQQLSDFSSLITALQQAWLAQTIAAENDITLIITPDVIRFDQTEISDTQRDLWLQLWQSVLNLCKSRRGIMGLLDAPDDPTLAAKCLQQFSSADRQWGVVYWPLLKSAYQDNTQNPIVLSPTAAVAAVIQRNDNQQGVWTAPANIALSKVISPVRAYIEANALFNPDGTSLNLVRSFPGKGIRIWGCRTLENTHDSPWSYIQTRRLVSYIEAYMTQLGRAFVFEPNNAITWMKFKGQAHNWLRQLWLKGGLRGTQEDQAFEVLLGVDESMREADLRAGKMIIKIRLAVLIPAEFIELNLTFDTRTGTIPS

Source Source

Source organism organism	Photorhabdus luminescens
NCBI taxonomy ID ncbi_taxonomy_id	29488
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	30862

Cryo-EM structure of the PlPVC1 sheath, 6-fold symmetrized (C6), in contracted state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qgp__assembly_1__model_1

9qgp__assembly_1__model_1 | I(q)

9qgp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of the PlPVC1 sheath, 6-fold symmetrized (C6), in contracted state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail sheath family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qgp__assembly_1__model_1

9qgp__assembly_1__model_1 | I(q)

9qgp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)