← Back to search

9qqn

Junin virus GP1-GP2 heterodimer in complex with Fab of JUN1

Method: X-RAY DIFFRACTION D_max: 142.8 Å Quality: REASONABLE

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qqn
deposition_date	2025-04-01
title	Junin virus GP1-GP2 heterodimer in complex with Fab of JUN1
keywords	Junin virus, glycoprotein, stabilized protomer, VIRAL PROTEIN; VIRAL PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	38.45 Å
rg_electron	39.29 Å
i0	122883000.00
molecular_weight	88707.0 kDa
excluded_volume	110660 Å³
envelope_volume	149460 Å³
shell_volume	36062 Å³
envelope_diameter	152.8 Å
shell_rg	38.84 Å
envelope_rg	39.47 Å
shape_rg	39.27 Å
total_rg	39.30 Å
total_atoms	6231
n_residues	762
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	142.8 Å
rg_real	39.25 Å
rg_real_error	2.19 Å
i0_real	1.2290e+08
i0_real_error	2.5580e+06
rg_reciprocal	38.76 Å
i0_reciprocal	122800000.0000
total_estimate	0.7375
solution_quality	REASONABLE a REASONABLE solution
n_peaks	2
r_peak_primary	31.3 Å
skewness	0.696
kurtosis	-0.119
angular_range	— – 0.2050 Å⁻¹
current_alpha	0.0000
highest_alpha	15790000.0000
n_real_points	42
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.479; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.384; Smooth: 0.762

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (9)

Entity 1 polymer

description	Pre-glycoprotein polyprotein GP complex
formula_weight	51709.8 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	6406

MGQFISFMQEIPTFLQEALNIALVAVSLIAIIKGIVNLYKSGLFQFFVFLALAGRSCTEEAFKIGLHTEFQTVSFSMVGLFSNNPHDCPLLCTLNKSHLYIKGGNASFQISFDDIAVLLPQYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWHLDPPFLCRNRTKTEGFIFQVNTSKTGVNENYAKKFKTGMHHLYREYPDSCLNGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRRRRAFFSWSLTDSSGKDTPGGYCLEEWMLVAAKMKCFGNTAVAKCNLNHDSEFCDMLRLFDYNKNAIKTLNDETKKQVNLCGQTINALISDNLLMKNKIRELMSVPYCNYTKFWYVNHTLSGQHSLPRCWLIKNNSYLNISDFRNDWILESDFLISEMLSKEYSDRQGSGDDDDKGSGWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Source

organism	Mammarenavirus juninense
ncbi_taxonomy_id	2169991
host_organism	Spodoptera frugiperda

Entity 2 polymer

description	Chains: C
formula_weight	23943.5 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	C

ETGSVVMTQSQKFMSTSVGDRVSITCKASQIVGTSVAWYQQKAGQSPKLLIYWASTRHTGVPDRFTAGGSGTDFTLTITNVQSEDLADYFCQQYATYPLTFGSGTKLELKRTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Source

organism	Mus musculus
ncbi_taxonomy_id	10090
host_organism	Homo sapiens

Entity 3 polymer

description	Chains: D
formula_weight	26402.5 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	D

ETGQIQLVQSVETGGGLVRPGNSLKLSCVTSGFTFSNYQMHWLRQPPGKRLEWIAVITVKSDNYGANYVESVKGRFAISRDDSKSSVYLEMNRLREEDTATYFCSRSGIYDGYYAYAMDYWGQGTSVTVSSATTKGPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRDCGTKHHHHHH

Source

organism	Mus musculus
ncbi_taxonomy_id	10090
host_organism	Homo sapiens

Entity 4 branched

description	;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ;
formula_weight	732.7 kDa
src_method	man
entity_count	1

Entity 5 branched

description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	570.5 kDa
src_method	man
entity_count	1

Entity 6 branched

description	;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
formula_weight	748.7 kDa
src_method	man
entity_count	1

Entity 7 branched

description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
formula_weight	910.8 kDa
src_method	man
entity_count	1

Entity 8 branched

description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	424.4 kDa
src_method	man
entity_count	1

Entity 9 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	175

▶

6. Citations (1)

▶

length_a	226.468 Å
length_b	73.030 Å
length_c	80.734 Å
angle_alpha	90.00 °
angle_beta	95.78 °
angle_gamma	90.00 °
z_pdb	8

space_group	C 1 2 1
int_tables_number	5
crystal_system	monoclinic

resolution	2.550 Å
resolution_low	80.320 Å
r_factor	0.2029
r_work	0.2011
r_free	0.2370

fit	/app/data/saxs_computation/qq/9qqn/9qqn.fit
pddf	/app/data/pr_computation/qq/9qqn/9qqn.pr.out
profile	/app/data/saxs_computation/qq/9qqn/9qqn.dat

Junin virus GP1-GP2 heterodimer in complex with Fab of JUN1

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (9)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 polymer

Polymer

Source

Entity 4 branched

Entity 5 branched

Entity 6 branched

Entity 7 branched

Entity 8 branched

Entity 9 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)