← Back to search

9qs8

Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z2997505083

Method: X-RAY DIFFRACTION D_max: 69.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qs8
deposition_date	2025-04-04
last_revision	2026-04-15
title	Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z2997505083
keywords	TrxR, Oxidoreductase, Fragment; OXIDOREDUCTASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.66 Å
rg_electron	21.10 Å
i0	40599800.00
molecular_weight	31902.0 kDa
excluded_volume	30241 Å³
envelope_volume	50627 Å³
shell_volume	20478 Å³
envelope_diameter	71.4 Å
shell_rg	27.22 Å
envelope_rg	21.22 Å
shape_rg	21.13 Å
total_rg	21.63 Å
total_atoms	2405
n_residues	305
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	69.9 Å
rg_real	21.68 Å
rg_real_error	0.50 Å
i0_real	4.0600e+07
i0_real_error	6.2660e+05
rg_reciprocal	21.68 Å
i0_reciprocal	40600000.0000
total_estimate	0.8937
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	22.9 Å
skewness	0.358
kurtosis	-0.463
angular_range	— – 0.3650 Å⁻¹
current_alpha	0.0000
highest_alpha	8703000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.885; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.966; Smooth: 0.993

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (8)

Entity 1 polymer

description	Thioredoxin reductase
formula_weight	34578.7 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B
atom_count	2630

MAHHHHHHMSTSQTVHDVIIIGSGPAGYTAAIYAARAQLKPLVFEGTQFGGALMTTTEVENYPGFREGITGPELMDQMREQALRFGADLRMEDVDAVQLEGPVKTVVVGDETHQARAVILAMGAAARHLGVPGEEALTGMGVSTCATCDGFFFRDQDIVVVGGGDSAMEEATFLTRFARSVTLIHRRDEFRASKIMLERARANEKITFLTNTEITQIEGDPKVTGVRLRDTVTGEESKLDVTGVFVAIGHDPRSELVRGQVELDDEGYVKVQGRTTYTSLDGVFAAGDLVDHTYRQAITAAGSGCAASIDAERWLAEQD

Source

organism	Mycolicibacterium smegmatis MC2 155
ncbi_taxonomy_id	246196
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	FLAVIN-ADENINE DINUCLEOTIDE
formula_weight	785.5 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	MALONATE ION
formula_weight	102.0 kDa
src_method	syn
entity_count	2

Entity 5 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	1

Entity 6 non-polymer

description	2-methyl-~{N}-(1-methyl-1,2,3,4-tetrazol-5-yl)-1,3-thiazole-5-carboxamide
formula_weight	224.2 kDa
src_method	syn
entity_count	1

Entity 7 non-polymer

description	DIMETHYL SULFOXIDE
formula_weight	78.1 kDa
src_method	syn
entity_count	1

Entity 8 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	186

▶

6. Citations (1)

▶

length_a	68.220 Å
length_b	68.220 Å
length_c	154.480 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	6

space_group	P 31 2 1
int_tables_number	152
crystal_system	trigonal

resolution	1.860 Å
resolution_low	46.930 Å
r_factor	0.2034
r_work	0.2014
r_free	0.2414

fit	/app/data/saxs_computation/qs/9qs8/9qs8.fit
pddf	/app/data/pr_computation/qs/9qs8/9qs8.pr.out
profile	/app/data/saxs_computation/qs/9qs8/9qs8.dat