SAXSdb — 9r78

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-protein VI

Human adenovirus D10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1680	Hexon protein × 720 （K7ZJY8） Penton protein × 60 （K7ZQ23） Pre-hexon-linking protein IIIa × 60 （K7ZMX4） Pre-hexon-linking protein VIII × 120 （K7ZJY9） Hexon-interlacing protein × 240 （K7ZLM2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7ZRR7_9ADEN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–234； UniProt 1–234 Author chain 2； PDBConstruct 1–234； UniProt 1–234 Author chain 3； PDBConstruct 1–234； UniProt 1–234 Author chain 4； PDBConstruct 1–234； UniProt 1–234 Author chain 5； PDBConstruct 1–234； UniProt 1–234 Author chain 6； PDBConstruct 1–234； UniProt 1–234 Author chain 7； PDBConstruct 1–234； UniProt 1–234 Author chain 8； PDBConstruct 1–234； UniProt 1–234

Hexon protein

Human adenovirus D10

UniProt K7ZJY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1680	Pre-protein VI × 480 （K7ZRR7） Penton protein × 60 （K7ZQ23） Pre-hexon-linking protein IIIa × 60 （K7ZMX4） Pre-hexon-linking protein VIII × 120 （K7ZJY9） Hexon-interlacing protein × 240 （K7ZLM2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7ZJY8_9ADEN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–941； UniProt 6–946 Author chain B； PDBConstruct 1–941； UniProt 6–946 Author chain C； PDBConstruct 1–941； UniProt 6–946 Author chain D； PDBConstruct 1–941； UniProt 6–946 Author chain E； PDBConstruct 1–941； UniProt 6–946 Author chain F； PDBConstruct 1–941； UniProt 6–946 Author chain G； PDBConstruct 1–941； UniProt 6–946 Author chain H； PDBConstruct 1–941； UniProt 6–946 Author chain I； PDBConstruct 1–941； UniProt 6–946 Author chain J； PDBConstruct 1–941； UniProt 6–946 Author chain K； PDBConstruct 1–941； UniProt 6–946 Author chain L； PDBConstruct 1–941； UniProt 6–946

Penton protein

Human adenovirus D10

UniProt K7ZQ23

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1680	Pre-protein VI × 480 （K7ZRR7） Hexon protein × 720 （K7ZJY8） Pre-hexon-linking protein IIIa × 60 （K7ZMX4） Pre-hexon-linking protein VIII × 120 （K7ZJY9） Hexon-interlacing protein × 240 （K7ZLM2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7ZQ23_9ADEN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–519； UniProt 1–519

Pre-hexon-linking protein IIIa

Human adenovirus D10

UniProt K7ZMX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1680	Pre-protein VI × 480 （K7ZRR7） Hexon protein × 720 （K7ZJY8） Penton protein × 60 （K7ZQ23） Pre-hexon-linking protein VIII × 120 （K7ZJY9） Hexon-interlacing protein × 240 （K7ZLM2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7ZMX4_9ADEN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain N； PDBConstruct 1–559； UniProt 1–559

Pre-hexon-linking protein VIII

Human adenovirus D10

UniProt K7ZJY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1680	Pre-protein VI × 480 （K7ZRR7） Hexon protein × 720 （K7ZJY8） Penton protein × 60 （K7ZQ23） Pre-hexon-linking protein IIIa × 60 （K7ZMX4） Hexon-interlacing protein × 240 （K7ZLM2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7ZJY9_9ADEN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain O； PDBConstruct 1–227； UniProt 1–227 Author chain P； PDBConstruct 1–227； UniProt 1–227

Hexon-interlacing protein

Human adenovirus D10

UniProt K7ZLM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1680	Pre-protein VI × 480 （K7ZRR7） Hexon protein × 720 （K7ZJY8） Penton protein × 60 （K7ZQ23） Pre-hexon-linking protein IIIa × 60 （K7ZMX4） Pre-hexon-linking protein VIII × 120 （K7ZJY9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7ZLM2_9ADEN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Q； PDBConstruct 1–134； UniProt 1–134 Author chain R； PDBConstruct 1–134； UniProt 1–134 Author chain S； PDBConstruct 1–134； UniProt 1–134 Author chain T； PDBConstruct 1–134； UniProt 1–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9r78
Deposition date deposition_date	2025-05-14
Structure title title	Human Adenovirus D 10 Capsid Structure
Keywords keywords	virus, adenovirus, capsid, conjunctivitis; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9r78__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9r78__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9r78__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	385.70 Å
Total Rg	385.70 Å
Atom count	11885760
Residues	764220
Excluded volume	107060000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9r78__assembly_1__model_1`	1680-meric （1680）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Pre-protein VI
Molecular weight formula_weight	25546.1 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,4,5,6,7,8
Atom count atom_count	198096

MEDINFASLAPRHGTRPFMGTWNEIGTSQLNGGAFNWSSVWSGLKNFGSTLRTYGNKAWNSSTGQLLREKLKDQNFQQKVVDGLASGINGVVDIANQAVQREINSRLDPRPPTVVEMEDATLPPPKGEKRPRPDAEETILQVDEPPSYEEAVKAGMPTTRIIAPLATGVMKPATLDLPPPPAPAPPKATPVVQAPPVATAVRRVPARRQAQNWQSTLHSIVGLGVKSLKRRRCY

Source Source

Source organism organism	Human adenovirus D10
NCBI taxonomy ID ncbi_taxonomy_id	28275
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Hexon protein
Molecular weight formula_weight	106268.4 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L

MMPQWAYMHIAGQDASEYLSPGLVQFARATDTYFSLGNKFRNPTVAPTHDVTTDRSQRLTLRFVPVDREDTTYSYKARFTLAVGDNRVLDMASTYFDIRGVLDRGPSFKPYSGTAYNSLAPKSAPNPSQWTANEKQTGGQPKSVTQTFGSAPMGGSNITIEGLVIGTKEEEGNATEEIFADKTFQPEPQVGEENWQETEAFYGGRALKKDTKMKPCYGSFARPTNEKGGQAKLKLNDQGQPTKDYDIDLAFFDTPGGTPPTGSGQQEEYKADIVMYTENVNLETPDTHVVYKPGKEDESSETNLTQQSMPNRPNYIGFRDNFVGLMYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSLGDRTRYFSMWNSAVDSYDPDVRIIENHGVEDELPNYCFPLNGTGTNSTYQGVKVKTGQDGAEETEWDKDETVARQNQIAKGNVYAMEINLQANLWKSFLYSNVALYLPDSYKYTPANVTLPANTNTYEYMNGRVVAPSLVDAYINIGARWSLDPMDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWNFRKDVNMILQSSLGNDLRVDGASVRFDSVNLYATFFPMAHNTASTLEAMLRNDTNDQSFNDYLSAANMLYPIPAKATNVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLTPNEFEIKRSVDGEGYNVAQCNMTKDWFLVQMLSHYNIGYQGFHVPEGYKDRMYSFFRNFQPMSRQVVDEINYKDYKAVTLPFQHNNSGFTGYLAPTMRQGQPYPANFPYPLIGQTAVPSVTQKKFLCDRVMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMTFEVDPMDEPTLLYLLFEVFDVVRVHQPHRGVIEAVYLRTPFSAGN

Source Source

Source organism organism	Human adenovirus D10
NCBI taxonomy ID ncbi_taxonomy_id	28275
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Penton protein
Molecular weight formula_weight	58631.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MRRAVVSSSPPPSYESVMAQATLEVPFVPPRYMAPTEGRNSIRYSELAPQYDTTRVYLVDNKSADIASLNYQNDHSNFLTTVVQNNDFTPAEASTQTINFDERSRWGGDLKTILHTNMPNVNEYMFTSKFKARVMVARKHPEGVVETDLSQDKLEYEWFEFTLPEGNFSETMTIDLMNNAILENYLQVGRQNGVLESDIGVKFDSRNFKLGWDPVTKLVMPGVYTYEAFHPDVVLLPGCGVDFTESRLSNLLGIRKKQPFQEGFRIMYEDLEGGNIPALLDVPKYLESKKKVEDETKNAAAATADTTTRGDTFATPAQETAADKKVEVLPIEKDESGRSYNLIQGTHDTLYRSWYLSYTYGDPEKGVQSWTLLTTPDVTCGAEQVYWSLPDLMQDPVTFRSTQQVSNYPVVGAELMPFRAKSFYNDLAVYSQLIRSYTSLTHVFNRFPDNQILCRPPAPTITTVSENVPALTDHGTLPLRSSIRGVQRVTVTDARRRTCPYVYKALGIVAPRVLSSRTF

Source Source

Source organism organism	Human adenovirus D10
NCBI taxonomy ID ncbi_taxonomy_id	28275
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Pre-hexon-linking protein IIIa
Molecular weight formula_weight	62170.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MQQAPDPAIRAALQSQPSGIASDDWEAAMQRIMALTTRNPESFRQQPQANRLSAILEAVVPSRTNPTHEKVLAIVNALAENKAIRPDEAGLVYNALLERVGRYNSTNVQSNLDRLVTDVREAVAQRERFKNEGLGSLVALNAFLATQPANVPRGQDDYTNFISALRLMVTEVPQSEVYQSGPDYFFQTSRQGLQTVNLSQAFKNLRGLWGVQAPVGDRSTVSSLLTPNSRLLLLLIAPFTDSGSVNRNSYLGHLLTLYREAIGQAQVDEQTFQEITSVSRALGQNDTDSLRATLNFLLTNRQQKIPAQYALSAEEERILRYVQQSVGLFLMQEGATPSAALDMTARNMEPSMYAANRPFINKLMDYLHRAAVMNTDYFTNAILNPHWLPPPGFYTGEYDMPDPNDGFLWDDVDSVVFSPTFQKRQEAPPSEGAVGRSPFPSLGSLHSLPGSVNSGRVSRPRLLGEDEYLNDSLLQPPRAKNAMANNGIESLVDKLNRWKTYAQDHRDAPAPRRQRHDRQRGLVWDDEDSADDSSVLDLGGSGGVNPFAHLQPKLGRRMF

Source Source

Source organism organism	Human adenovirus D10
NCBI taxonomy ID ncbi_taxonomy_id	28275
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Pre-hexon-linking protein VIII
Molecular weight formula_weight	24660.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P

MSKEIPTPYMWSYQPQMGLAAGASQDYSTRMNWLSAGPSMISRVNGVRNHRNQILLEQAAVTSTPRAKLNPRNWPSTLVYQEIPGPTTVLLPRDALAEVRMTNSGVQLAGGASRCPLRPQSGIKTLVIRGRGTQLNDELVSSSIGLRPDGVFQLAGAGRSSFTPNQAYLTLQSSSSEPRSGGIGTLQFVEEFVPSVYFNPFSGSPGLYPDEFIPNFDAVREAVDGYD

Source Source

Source organism organism	Human adenovirus D10
NCBI taxonomy ID ncbi_taxonomy_id	28275
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Hexon-interlacing protein
Molecular weight formula_weight	13773.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S,T

MNGTGGAFEGGLFSPYLTTRLPGWAGVRQNVMGSTVDGRPVLPANSSTMTYATVGSSSLDSTAAAAAAAAAMTATRLASSYMPSSGSSPSVPSSIIAEEKLLALLAELEALSRQLAALTQQVSELREQQQQQNK

Source Source

Source organism organism	Human adenovirus D10
NCBI taxonomy ID ncbi_taxonomy_id	28275
Host organism host_organism	Homo sapiens

▶

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	5524

Human Adenovirus D 10 Capsid Structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-protein VI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hexon protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Penton protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein IIIa

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hexon-interlacing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9r78__assembly_1__model_1

9r78__assembly_1__model_1 | I(q)

9r78__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (2)